dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_018353323.1.14990 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: plexin-B [Trachymyrmex septentrionalis]; AA=GCF_001594115.1; RF=representative genome; TAX=34720; STAX=34720; NAME=Trachymyrmex septentrionalis; AL=Scaffold; RT=Major
Sequence length 2034
Sequence
MRFLGFTQSFPKSPTVTHLQVPLPPLLHRLSFSSMSIATWFLVILVTAAIDTPASTVPPI
QDNKSPHIIAQFPAGNGQRYGHFSLDANATREGALRFNHLAIDPSSGRLYGAAINRLFQL
DSNLRLEEYVSTGPRLDNPQCHATGCMARDIPTSLMDNVNKLLIADVKSQMLIACGSLLQ
GACEKYQMSNISIKPEFIPHSVAANDENSSTYAFIGPEKYNPWEQTNILYVGTTFTNKGD
YRHDVPAISSRNLDNLEFAEYTFNKQSIVYIDVKYRDHFLVKYVYGFNASDYAYFVLVQK
QSYLPEQEELGYISRLARSCISDPNYDSYTEVTLQCTVDLGDGKQHHYNLVQDAKVAAAG
SDLAMQLGISVGDPVFVSVFSPSRGITNEPLSRSAVCIYSLQDIETKFNENIHMCFNGSI
KYRNMGYVSGPIQDGKCPTAGTTGNILNFCEVGLKISGVSPITGQAILHFPDTFISSVTI
ANTESHTVAFFGTSDGVLKKVLLSGVEAFVYESVTIDKGQKLLPDTLISPDGEYIYVLSN
SKISKVKVEHCNGYTNCSSCLDAKDPYCGWCSLEKRCTVRGDCQKASHSSPRWLSLGTGQ
QCIDFEQVLPDRMPINQMTTVQLTIRTLPELPTGANYKCVFGNAEPIDALMTGFGLSCPT
PPVVERPSIPEGADHVLVPLSVRSSETNKDFVSRNFAFFDCSRHTVCTECVKSQWACSWC
VYDNKCTHNTSCQGIISGENQNQANLAAHGAQYCPRFMERKEPLMLPNSVPKEIVLEVEN
LPHPQVGHSGFQCIVSIEGANLKVQARVDSSRFIVCDKTVYSYEEVSGEYEAEVTVVWNT
NHHVDKTTIILYKCEVLGSHREHADCSLCVTRDARFECTWCGNSCVYRHSCLQSPFTECP
KPRIDMIKPLSGPIEGGTLVTIEGSNLGLKESDVEGKIHIGNTPCTLVDYEVSVRIVCRT
GRHEATDAASVVVGNDAGYTESAVLFNYKDIRLSGVYPSVGPQSGGTQLAITGKYLNIGS
TISAYLDELPCHVNATQASSTRLTCVTSKSGRVRRIHRLTLSIDGANRTLMDNPYNYTHD
PTIMEIKPLRSFASGGRMITVHGTNLDTIQKPEMEVYFDNEQLPVNRTVCTVLNPTQMEC
PSPSVAKRFVSIRRSERSAATSTLGTSSPHSLRLKESQLSLKIAFIMDNVESVRDLEKQS
LRNRLLYVEDPTFFPFPRNVKLYKGDTLVIEGENLNYASDESDVNVTVGIMPCNVTSLAL
TQLVCTPPDQQPADTDELGIKTESGLPLVVVRVGRSLRFPIGYLRYEVIKSYPIPPEAIA
GIAAGTFGLIFLFVLVLVIYRRKSTQAEREYKRIQIQMDTLESNVRMECKQAFAELQTDM
TDLTADLESSGIPTLDHKNYIMKVFFPGVIDHPILNDPRSRSNISRTNYDAAMIQFEQLV
NNKYFVLTFIETLEAQKDFNIRDKVNVASLLMVVLMGKMEYATDILMNLLLRLIDKAVNT
KHPQLMLRRTESVVEKMLTNWMALCMYNYLKDYAGSSLFLLFKAIKHQIEKGPVDVITHD
ARYSLSEERLLREQIEHTIVTLHVVQDDLDEKIQCKVLDCDTISQVKSKILDALYKNTPF
SLRPSVHDVDLEWRHGRGGHLTLQDEDLTTKCCGEWKKINTLAHYGVKESAVMSLIPRQN
DGFSVACKPPCHNCKPSHYHPQQQPSIHPHHQPSHHHLHRHSNHCSSTHLPSTPNHGLIT
PVMYNHPVSGLYFDSQHSPPIITANGDVESAHGGNQRLYHLVRPIEDVHYPPGLGFTGSS
KHHHPERTHKAIPEIFLTRLLSTKGTVQKFVDDFLNTILTANEALPSAVKWLFDLLDEAA
KQHGIVDPEVAHAWKSNSLPLRFWVNFIKNPDFMFDINKSTTVDSSLSVIAQTFMDSCSM
TEHRLGKDSPSNKLLFAKDIPHYREKVGRFYTDVQRLPQITDQEMSSAMQQLSASHANEF
DVIAALKELYIYVSKYYEQILEALETDAGCRKLHLAHRLENVAYTLEGEETSAC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]