dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_018415576.1.44173 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: ankyrin repeat and SOCS box protein 12-like [Nanorana parkeri]; AA=GCF_000935625.1; RF=representative genome; TAX=125878; STAX=125878; NAME=Nanorana parkeri; AL=Scaffold; RT=Major
Sequence length 440
Sequence
MLRYRGLEDDHVESRELHLAVSLDDPQHLAKLLSLDRYKNYVDSRSGWGVPMTPLRQAAS
NGSVECLKILLANGAEVDSLDVKAQTPLFAAVSGGHSECVRVLLEAGANPRGSVHNNCTP
VLTAAREGNAQILKELLEYGADANVRAKLANRATPNPGCTGPLYLAAVYGHLECFRSLLL
YGADPNYNCTDLQLLKKMKHPQSVLEICLKHQCHPEFVKLLIDFGADLYLPNVHAMSLSD
SPSLKLIEREKGFPGSLMFQCRVTIRRLLKQMGKLHLIDQLEMPDRIVGYLQHHNSYCQR
QDLEICNQRFYSQPASSLNFPPVSSLPLDPVDGVRSGPWLKCTSIPISSCSFLQACGKVG
IFYGLPVTAVVGGGGQVEAALVQEHQSAEKGRWSPERREQETAEARGLERSAAEIHDAVQ
IHDHQQQSFMALGATQTRSV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]