dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_018642649.1.24268 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment erythrocyte binding antigen-175 [Plasmodium gaboni]; AA=GCF_001602025.1; RF=representative genome; TAX=647221; STAX=647221; NAME=Plasmodium gaboni; strain=SY75; AL=Chromosome; RT=Major
Sequence length 1659
Sequence
MKSSTGIYFFASSFLLYFAKATNEYDIIENEKTLDVDKEKFNELDKKKYENVHTTNKKIF
SFIENKLDILNNSKFNKRSKTYVTPDNIDKKISLINKHNNQGTFNNNYQSFLSTSSLIKE
NIYVPVRATRVSRVLSFLDSRLNNNKNSQINSGDLSNCMDKRRGMKWNCKRKDNKNNYVC
VPDRRIQLCIVNLSIVKKYTKETMKNHFIDAAKKESQLLFKKHNNNYDSNFCNDLKNSFL
DYGHLAMGNDMDFGGYSTKAENKIQEVFKEAHWRPTQQEIKNLRKTWWNEFKKGLWEAMI
SEHKNKFPSCRNIPEEVPQINQWIKEWNDEFVLEKNKRLETPKSKCKENKLYEACDKVCI
DPCMKYRDWIIRSKFEWHILSKEYKAKNGSNKNPEQYLLDVSNKRNGENVSTMLKNCDNE
YSKYCDCKHTTTLVKSVLNGNGNTTEQERETVDLEDLSKFGCREKSVQTTNKIWECKQND
ILSVNGVCSPPRRQEICLGNIDRIYDKNLSMIKEHILAIAIYESRLLKKKYKNEGNDKVC
NVIKKSFADLSDIIKGSDYWNDLSNRKLVGKINTNSNYVHRNKENDRLFRDGWWIDIKKD
VWSVMRWVFKDKNFCKENDIENVPQFFRWFNEWADNYCQEKTKMINVLKEGCKKESCEDD
KCKTKCNSFKEWISKQKNQYNEQVTKYLEYQKGNNYKIYPEIRFMKPHDYLKNYSKKCSK
VNFEIEFNEIVDSDYKNKCILCTKVKDIPTAVASNVLNTPASEVPEIKSQINSMNIDNSS
GTIKGDTQETDTSHNKDNAEGLSKENVEIIGETKQEAENQKDQEKLKKESMNAQEREQEK
STTELSEDLKESTRDGGEEIPILSDKMNTNVEQTSEESSNIHQKDESEEKSPVLEENTHN
EEEQHKESLASSDSTDEEGLSENDREQQDNKVSDDTLESSVGTLPKENRSDGQEAISSIT
EASRRDEENVQAIENTLTESPVSINPSGTEPNNEDTSEEQGLKQNVDISGSNKVVEDIVM
DHIKDAEHEDEGTRENSNDVSGHVGQQQEELQDGTHDASDATHVDKEREGTSINITDESE
DASTLTSEHNSVNTTTSPVNGNNEGEVVDAKDKGVRPEETEQRHVESTENVENSESVDEE
SARTSENLNASDRNDSEFKTHQLDSSPINNVNSDPKEITIPSSNVRNDLETKEENQPSSD
TYTDKNSEEQVDRNVDENLNDTLESSADISNKRISDEQLPEGIVSSAQNDYSADGHSHDM
NEESTEITPNNKSEVSDGENEEELTRQYENIVLKNDMESESNDEQLEGDEGRVDEKGISE
TLDGNIEKLNNDDQEKDKLLVRDLEKANVQTEMNLPDTKENHEQLRESKKEEIVKDSKGN
PSDTHVDRNDHILPLKDMVNGENERRQLQNPNVSIGEERHLQEHKFHTMNNLHGTRGSEK
NQINHGHHGKRHDLGNNSKSVLSTESNDPNFNNTPGRYNLNGEKLNIEGYKNRDDVRTRE
EIKKLAEINKCENKISEKYCSHIIEEKIKSNICSIEKTRNMCCAVSDYCMRYFTYDSKEY
YDCTNKEFRDPSYICFRKEAFSRMPYYAGAGVVFIILLIFASLHAKDQSSDEVVKEDNGN
NFAFEVTDNLDKLSNMFNQQVQETNVNDFSEYTEDINAY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]