dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_019778716.1.83887 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: uridine 5'-monophosphate synthase [Tursiops truncatus]; AA=GCF_001922835.1; RF=na; TAX=9739; STAX=9739; NAME=Tursiops truncatus; AL=Scaffold; RT=Major
Sequence length 480
Sequence
MAADDAALESLVTGLYDVQAFKFGNFVLKSGLSSPVYIDLRGIVSRPRILSQVAEILFQT
AQNAGINFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGAINPGETCL
IIEDVVTSGSSVLETVEALQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKML
EILEQQKKIDAEMVERVKRFIQENVFVTANRNGSFPSVKKGPKELSFGARAELPGIHPVA
SKLLRLMQKKETNLCLSADISESRELLQLADALGPRICMLKTHVDILNDFTLDVMKELTI
LAKRHEFLIFEDRKFADIGNTVKKQYEGGVFKIASWADLVNAHVVPGSGVVKGLGEVGLP
LHRACLLIAEMSSAGSLATGSYTEAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGITTSANRLDAAEMYRKAAWEAYLSRLAL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]