dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_020016072.1.5219 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment zinc finger protein 709-like isoform X1 [Castor canadensis]; AA=GCF_001984765.1; RF=representative genome; TAX=51338; STAX=51338; NAME=Castor canadensis; AL=Scaffold; RT=Major
Sequence length 717
Sequence
MKTSVESVTFEDLAVNFTHEEWALLGPSQKDLYRDVMLETFSHLASIGNKWEGQNIKDKH
KNPGENLRYIIPHSGYKPYEHEEYGEKQYKCKQSGKTVISLTSVQGHMASHNVNGPYECK
VCLKTFDFLSLFQIHQHTHSAKNPHERKQSGKAFVCSTSFQIRRSTHTVEKFYGCKQCGK
VFRHLRYLRVHEKTHSEENPYVCKQCGKSLSCSSALKLHERTHSGEKPYECKQCGKAFRR
RSYLRVHQTTHSEERPYECKQCGKVFKTHSSLQVHERIHTGEKPYECKQCGKAFTHLGYL
RVHERTHTGEKPYACKQCGKTLSSSSYLRVHERIHTGEKPHECKQCGKAFRHLSHLRAHE
RTHSGEKTYECKQCCKAFIHLWSLRVHERTHSEEKPYECQQCGRTFSCSRSLKLHERTHT
GEKPYACKVCGKVFIAHSSLRIHERIHSGDKMYECKQCGKTLSCSSSLKLHERTHTGGKP
FGCKQCGKAFRHLSYLRVHESTHTGENYECKQCGKAFRHLSYLRIHERTHSAEKPYECKQ
CGKTLSCSSYLRVHERTHTGEKPYECKQCDKAFSHHNSLLLHERTHTGEKPYECMQCGKV
FIDHSSLRRHERIHTGEKPYECKQCGKTLSCSSSLKLHERTHTGEKPYECKRCGKAFRYF
SYVQVHERTHTGEKPYECKQCGKSFRHLSSLQVHERTHTGGKNLTNVNNVKKPSGIC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]