dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_020306909.1.37734 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein LOAG_16896 [Loa loa]; AA=GCF_000183805.2; RF=representative genome; TAX=7209; STAX=7209; NAME=Loa loa; AL=Scaffold; RT=Major
Sequence length 298
Sequence
MTKLFIFTFFNIWTIAPSKCFMRLSSSEELHGNSCGDTSSPIFAQTTSSTFYSPNHSAST
SVHVPATTHRIQRFISFFSSGDTQTKHWETTSSPTTVRFPSRRRLKRSTTATTTPISASL
LATPIPLGDVQKQGQLMHQEMAMGEPVKNDRHKWTTYWVVLHGTKLYLCCQLSSHINDET
HEKLLNIPSDARQIDLKSAIVDIAYEYCRSKDNKKAHVFRVITQQQTEHHFQTYCEDDML
KWIEIIRFASSNLISSQSDHGTVSTGVTSNIDLSSNVPNNWSTVTKFQSDNNSSDQCK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]