dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_022072699.1.10920 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment low-density lipoprotein receptor-related protein 6 isoform X2 [Acanthochromis polyacanthus]; AA=GCF_002109545.1; RF=representative genome; TAX=80966; STAX=80966; NAME=Acanthochromis polyacanthus; ecotype=Palm Islands; AL=Scaffold; RT=Major
Sequence length 1495
Sequence
MGVALRSLLLCTFCFLVRGEPLLLYANRRDLRIVDAAHEKSNATVVVGGLEDAAAVDYVF
SQGLIYWSDVSEEAIKRTFFNQSGGGAVQTVVPGLASPDGLACDWLGRKLYWTDSETNRI
EVSELDGSLRKVLFWQELDQPRAIALDPERGFMYWTDWGEIPKIERAGMDGTNRSMIIDK
EIYWPNGLTLDYGQQKLYWADAKHNFIHRCNLDGTSREVVVKGELPHPFALTLYEDTLFW
TDWNTHSIHSCRKQTGAEQRVVHSDIFSPMDIHVFSTKRQPDLSSSCSLNNGGCSHLCLL
SPVKPFHQCACPTGVQLLEDGRTCRDGATQMLLLARRTDLRRISLDTPDFTDIILQVDDI
RHAIAIDYDPVEGYIYWTDDDVKAIRRSLLDGSDAQFVVTSQVNHPDGIAVDWIARNLYW
TDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLDGM
ERVVMVNTSLGWPNGLALDYDQRKIYWGDAKTDKIEVMNMDGLGRRVLVEDKLPHIFGFT
LLGDYIYWTDWQRRSIERVHKRSAEREFIIDQLPDLMGLKATYVHKTFGTNPCAENNGGC
SHLCLYKPQGVQCGCPIGLELIADMRTCIVPEAFLLFSRHTDIRRISLETNNNNVAIPLT
GVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNL
YWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAAMD
GTGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGQDREVIADDLPHPFGLT
QYQDYIYWTDWSQRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQGGWNACASTNGH
CSHLCLAVPVSSFVCGCPAHFSLNYDNKTCSAPTSFLLFSQKMAINRMVIDEQQSPDIIL
PIHSLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQSMTVVSSSLSGPNQGLQLYDL
SIDIYSRFIYWTSEVTNVINVTRTDGSRVGVVLRGEHDKPRAIVVNPERGYMYFTNLLER
SPKIERAALDGTEREVLFFSGLGKPVALAIDNEVGKLFWVDSDLRRIESSDLSGANRIVI
ADSNILQPVGLTVFGNHLYWIDKQQQMIERIDKTTREGRTKIQARIAYLSDIHAVHELDM
REYGKHPCTWDNGGCSHICIVKGDGTTRCSCPVHLVLLPDELSCGEPPTCSPEQFSCTSG
EVDCIPQAWRCDGYPECDDSSDEEDCPVCSESEFQCDSRQCIDLSLRCNGEINCQDRSDE
NKCEVRCPADQFTCSNGQCVGKHKKCDHNMDCTDNSDEIGCYPTEEPPQPPNNTISSIVG
VVMALFVVGAIYFVCQRVLCPQMKDDGETVTNDFVVHGPSSVPLGYVPHPSSLSSSLPGM
SRGKSVIGSFSIMGGSGGPPYDRAHVTGASSSSSSSTKGTYFPPVRNHHRPSVEV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]