dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_311427.4.40869 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment AGAP010715-PA, partial [Anopheles gambiae str. PEST]; AA=GCF_000005575.2; RF=representative genome; TAX=180454; STAX=7165; NAME=Anopheles gambiae str. PEST; strain=PEST; AL=Chromosome; RT=Major
Sequence length 1350
Sequence
FGDFFQNILERAEKRAAALGITNTSKFPLSEFNYEADQQGSAAGASPKKKSGGAAGASPK
KKSVTKKHSAPKPPPPTTTVSTRTATDGERTTTVDIGGQDNCDLALEINITTSANLQVDL
GVKELENDGSVKKQWEHNIVRALEGEKENSAEAKSVIRDQSRNQLQRLGTLYSETQDLSS
PVHRTEGRFHEDVKQSSNKPKPKLAKLAMLADSINNWEDDTSHPDITHHRETIVPGRERK
SPISSSSTRQQSPKRAGEARTGASGSSAPGTGATPKKYPAPNPPKSILTATQKTGSNGGG
EPSSGAAGKPVQTKSLKWDQKVMDTLESQGFQRRESTTSKLVYDYKEDKNGQKTDTYRAP
VTASAVSSTSRERNTTQADQADAVKKSAPVSSSSSQPKKVAVGAPKPAGGLVSGRAAMFE
KSSGRRQSILKPGQKDPAEMSLKERMAIFEKNKGAALVPKAAFGISPSIRQITGQKEGGK
SGSSGSGPMSCAAIQGSGFGSITQQAASSKGVAPASPQSKPKVDHDKAAPKVETKATGSA
IRNTVEALMSDTSTISQSEISEEIRRMRQQEMEMLLNRFTKPADMSSDTIEYETQPIPSA
PPMPPEGYLTGSGRKQSKHSAEGNNVHDGTNDSADVMAALDDVKRIRVGPAAKDGRMYPA
LSDIETTATESGDEGAVGDDYTTATVSGSEGSERAYRTCYGEAEDGERELGDEEEDYDEE
EDNERRHFMYSDDDEEANIANVSLGREILQAVKLNDRRTSRGRRQSQEWNGVSFSLDRSG
ASDGTDPLEDSDLIDACLEEALVDEEEEEEDSEAFDTPRKSSVSSNSFSYQKHSGRDRCA
TINEEESAKDPKSGANKRKSGTPRKSQVGTVDYSSPVRSELQVKPSKDDDDMVTLVHTVS
FYRRQQQQNSMTPRKVPRTPVSTKMAATNSSPRAGTSTSTGTEEGEFLVQEKVKKLLDEV
CKQQTIIAQASQALNLCAATIEFSGSTESAEGERHLLVATHRRQAILDEVQRLRVEGCLR
PPGAPTEKGRLTVKEITLPLKQEYMRKLATDQISGHNLVCLLKYNETVLATQTAPTLPGL
LSVRFPDVLQLSNVFADFKITMEIYGMPASREVLPHEIKYHIALGKKKTGSGSSKLLHTP
KGLKSNSRLIMPPVQSPAGPQAVRSPSLTQYGFIIFSLKEIQRTSWTLNPISGCASPLDG
TVNMRVNCELAVTVDYHGFLTMYEDVSGLGAWHRRWCRLQRHTINYWKYPDDEKRKAPIG
SIDLQGCSTQRVGVAPRDICSRLNTLLLEFPRPARDDDVESLKIVRHGKTTIERYLLSAD
SKEERDEWCAHLNKTLALLKAWGASHVTSC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]