dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_647525.1.73096 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein DDB_G0268060 [Dictyostelium discoideum AX4]; AA=GCF_000004695.1; RF=representative genome; TAX=44689; STAX=44689; NAME=Dictyostelium discoideum; strain=AX4; AL=Chromosome; RT=Major
Sequence length 814
Sequence
MGDHLKNTREWIRHSSNKDDGNNAEKTHFFGHHEEEDHEHMLFTKEELTNPKELAKAMKV
KIPLYVPIFNWIKSYSKEDLIGDILSSITVATMLVPQGLAYAVLAGLPAIYGLYSGWLPL
VIYSFMGGCKQLAVGPEALLSVLLGSILGGYTTPPEDMTLNDYLVSIALTLALLVGIVSF
LFGICQFGFLGGILSRWVLSGFINAVALIIAISQLDSLLGVRTGGGGHTSDTTHGSTSTS
ISGSTISSMSEVLTETSTHHPGPYEKFWTAITNLQDSDKTTVILSAGCVVFLVGMRFFKQ
FLVKKMGWKNAKYIPEILLTVILTCVITAVFGLDRECVNTSDHDENKCVEQGSGVSVLRY
VKGGFPTVGFPSFQANTIQELLPQAFLIVIVGFVEATAVSKGLATKHNYQINSNRELVAF
GVANILGSIFGSYPVFSSIPRTSIQDMAGSRTCLSGFITSCLLLITCLFLTRLFYYLPYC
AMASIIFVAAFGLIEVHEAMFLWKTRSWGDLIQFSIALLATFIFEVEVGILISVGMCIFL
VLKHSSSPHVYSVLGRVPGTNRFKDVAKFPEAEPIEGILLVRIDEVLYFANIGQFKQLLS
EIERMMDRSTNVTGSGSTPLQSIIINVVNIPVMDASALLTIEEMVTAYHKRNVKVAFVQM
SEKIKESFKQSGLYDIVTPQFIFDSNYEAVSFLEQSINYSNNNDSRQVNLNMPQSDQSYD
DLNNNEVGGFDQPSSSSSSRFNNQNFLNKNNDNNNNNNNNNNDNNINDDDYQNSYNNNNN
NGGGAILSDGLKLEDYSEPESDEFIQSSNQKSKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]