dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_676553.1.11252 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment merozoite surface protein 8 [Plasmodium berghei strain ANKA]; AA=GCF_000005395.1; RF=representative genome; TAX=5821; STAX=5821; NAME=Plasmodium berghei; AL=Scaffold; RT=Major
Sequence length 409
Sequence
MKRSSQIIIFLLLSLVCKFSIGICKENGNGNINKSNNNRVIKKERKRKAKSNANKNEPEN
KEHEIINLYDDVQELLGNERMSMLDKYSILGIDDCSNESENNKIIGEYDLKAMKSVLLYK
NRISKVSLENLYDVKTVFKRCFNKDDPELSKSYEHLQDQAAIEGTTIIDYLSNYILNVYV
KMNDEFIKNDGFKLSKYIPELEIINYALYNGPKELENRIKSGLNEINNIIISESLTSIYS
SVVSGLNINCKIKDDLITILNLSDGKYFKVDFSSQATMIVPGQYSHEHGNMKKISEYFIE
KNRICKNEKCPINSNCYVIDNVETCRCIPGFSKNKESESLKCDIDESTSCENNNGGCDVN
ATCLLLEDKIMCECNNKYNGDGIYCSNAIYYGMNVFVFFLISIVCIYIM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]