dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YP_535705.1.8253 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MarR family transcriptional regulator [Lactobacillus salivarius UCC118]; AA=GCF_000008925.1; RF=reference genome; TAX=362948; STAX=1624; NAME=Lactobacillus salivarius UCC118; strain=UCC118; AL=Complete Genome; RT=Major
Sequence length 115
Sequence
MPVDTENKYTLCPKFTKTFGILGRKWNGLIIEVLLEKGPQRFRNLADSVDKCSDRVMVER
LKELEDEGLVERMAQPGSTRVLYKLTPQGEDLKEIMSDIHKWSDKWYSVEDCANS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]