dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSACAP00000017993 (Anolis carolinensis 76_2.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel scaffold:AnoCar2.0:GL343713.1:235184:246484:-1 gene:ENSACAG00000024511 transcript:ENSACAT00000025558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 722
Sequence
MEKEKSSSVLMEPRVKMEEPNQTSPEGGREPCTMWGRRSVRFPRRMGQDSLEEKAFSADI
QCQHFRHFCYEEALGPREVCSRLHVLCRLWLKPEERTKAEMLDLVLLEQFLAVLPAEMER
WVRECGAETSSQAVALAEGFLLSQAEEEKIQEKEPEGEILQAQEVPLETSQRFSSRWIKL
EEEEDTRPAPPGDEPSMLGRFNRSSLYNPAASLQWEQMTFEDVSLHFSKEEWELLDSDQQ
TLHWEVMEENYKMLASFGGPGQVSEYAPCKTWLKTEDCKDEEAENLRMEAEVYRGNQCAA
DIREITIQETIDESREIGNSLACENRFFHEASYPSDDIANHIEKGQPKCNQLEESFGSNI
HLTNYEGPQIVNKTYKRLGCGISFAEKRNLIAHERNNKGKCGNSLSCEYELKKHRNGHPE
EKSHICLQCGKSFHSIKYLNRHQKTHKGERPYKCPDCGKCFHLKGALNVHRRTHTGEKPY
KCLECGKSFYQKGELQRHQNTHTGEKPYKCLECGKGFADKRNLTGHERNHRGEKPYQCLE
CGKSYIFKAGLKTHQKSHIGECGKSFSCQTVYRNDTEEKSQTCLECGKSFRRRSSLKIHQ
RTHTREKPYKCQECEKSFHQKGDLDKHQTIHTGEKPYKCLECGKGFMQKRSLLLHEMNHR
GDKPYRCPKCGKSFNCQSVLKKHQNSHIEEKSHTCLECGKSFRWRASFKVHQKTHAGEKL
NK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]