dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|17232603|ref|NP_489151.1| (Nostoc sp. PCC 7120)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein all5111 [Nostoc sp. PCC 7120]
Sequence length 962
Sequence
MMKVSSVGLVLLNQLSLGFMLIWCHTAHAQVTSDGTTNTIVNPSGNNFHILDGIEKGNNL
FHSFSNFSVPTGGSATFDVTNTPNITTIFSRVTGGNISQIDGLIQTLGGNHQVSLFLMNP
NGIMFGQNAKLDIGGSFVGTTANSIKFTDGTEFSAINPISPPLLTMSVPIGLQMGSSASS
ITVQARPLQVDTGQSLVLLGGDIDLNGTGNARLLARDGQVILGSVASENFVPFSFSNARF
NFDFSGIPTFQTVQLRNGFTVDVNGSRGGNIQIHGQQVNITGNSQLMANSTGKTADGEGV
VVRASDALNIINSEIRVRLTADAQGRGGNITLAAPVMQITGNSNIATNLRGNETFGTLGL
DKGSNITITSQDFLLLGNATSRTGNGSARITTQGQGGVGRVGDIRITADRVRLLNNARVI
TDVTSTPVGGKAQAGDVVVNAGDVEISGSSSSQINSWISSTLERETSGWGGNIEINASRS
VRLSDSGTIRADSFGNGNASNITIRTPDLEIVGTNGLSRQSRISSSTAIFAAAPGFQAGD
IQIETQRLRLLDGGSLLVSSETKSSSGSINIKATESVEVIGAALDDRGGWRISGIDASSR
GEPLPNGDPGDISRINITTDTLRVLNSGAIKSSVTGDRIGGDISINAHTIEVGGRAVHSE
TMPTSQISSAASNPLTPGAGIAGNISLTTNRLFVRDGGLISVSGQDQAQAGNLQITAAQS
INLAQNSSLSAVSSVGDGGNINIDLNSSGLLYLRDMSQISTEAEGNGNGGNININHALFV
LGLENSDIVANAFQGRGGNINITTQGIIGLEFRNTLTPREDITNDITASSQFSVNGTVQI
NNVGIDPNSGVVELPTNVSDPSQQIANACDSNQGSSFIATGRGGIPQNPMQEVRSDRTWS
DTRDISAFQNTPQIQAQTPIQPQIPIQATSWHRNTQGKIELIADKSSVNLQPSLTCAAVN
KS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]