dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|17233133|ref|NP_490223.1| (Nostoc sp. PCC 7120)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein all7117 [Nostoc sp. PCC 7120]
Sequence length 102
Sequence
MIQGKYPDNWKQLATALKAASNWRCSKCGRVCLRPGEKPDNLTFSERKAHTLQVHHWNRD
PSDNRLENLVCLCSGCHLSYHRFGRGNVSPGQLSLFAEQKVS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]