dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|76801464|ref|YP_326472.1| (Natronomonas pharaonis DSM 2160)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein NP1628A [Natronomonas pharaonis DSM 2160]
Sequence length 257
Sequence
MVDVLDNKRSATKFRVLVEIADRQPAVNQGEIADAVGVTSQAVSEYIRELVDEGFVEKEA
RSRYRVTKEGVDWLFQQAADVSRFAEHVTEDVLGSMQEDAAFAADDIAAGETVSLSISDG
LLYATPGDSGPATGVATTDAETGDVVGVTGFAGIIDLDPGSVTVFQVPPIRSGDPSGSPE
LADTAADADVVAAAGVEGVAALRDVDADPDVTFAAGEVAADAAGRGLDVVVVATTDLAGR
VTDALRDAGIAYEVDDI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]