dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

TEQG_05572T0 (Trichophyton equinum CBS 127.97 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 1563
Sequence
MDDPFVATPLAAVQSQREPHRYSSFDNQLLTLNSSSPSQLKRALEIHLAETDRRLEETSR
LGTALVRQQQELADKLKEVEQQEDEGEIGPELREKLLALERDYNEVGRESARTTFGAKPR
LLAPEDTPLDSRTPSSPAFLSSQATNSPSKVSVPSRRQRNQPASRIHDIEFATEISTSLL
TQVRQLQALLAERDEALRETNLEKSRLELEAEGFSQRIRSLDESEQRYKDENWRLETQSH
ELMAAAKEAAARENRLTANLNALTAKKNSVQRELDELKQANGKLMEEHSAAQKAHDSELH
ILRRNLNTGDAERNNLRKKVDELVGQNQELAKAVAAKLRQHESEPARNVDTETKNNDDDE
DTPENSPPPSPNKATPRHGHLESETLKSSLHHAHRMIQNLKSSIHREKSEKIELKRMLQE
ARDDLEARRNEIAAAQGSSQKRHKTKAEIFKKPPRPDMLGAGRRGITEIELDEPDWEDEE
VMEPSPTKTVRPRQTSVVYTRPRPRPRSGYVSASDAYQTANETEDGGFETAHETETATES
ENFQTGTEDMAGDSSDELTETEGRAVGQTAMPRTKPYKLRNAKAGDRSSFMSTASTSADE
DDYPYNEVHTPVQSHPPRYRLKMQRGRHARSSEETIQAGGSIGYETQSPGGSLHTPKSRV
EGGRSLFAELGEAGMGSDGEFGSPLQQPNNNPVSAESTPIRNLSCLQNKDADQPPRVAMI
DSSMMTEPWPAPAPASGTVATQTLAPQTANATTSTTSAVLVDSSTQSIVSKRPPITQTEA
MVVFSTLPSEPVKSVDMATQCSPVKSQPMAQTGPVVIHDTPPAEPSKSTAVDMATQYASA
KPQAMVQSEAMVMFDSPPVATPAEDRSRDIIAPIPVPLPITSSSPDPEPAPEPIKLEHSP
IMFEETTPVLPPVVEQPRRSSMHLAYSDVTFEQSRPVTPLPIPAALPVPCTPPKYMASSI
QTIDTPPISPPTEPEVVKPFIQLEMSSIYAESTTPVIPEPVPTIIPPVVALGTGSETEMS
PRRPRTAVHDKDTEAPSPLESSREIMPPPKFVTEGTGSMKSKQPLRLFAPASVTENGAQT
ILTSKQIDSLLLDKYVMPPPKTPESRALAPAFPGSLEEAALATPRAKTQPSSANDNFLLP
NAAAKRPGSAGSRRSTMVHPPLPPDHKQAIAAAAQRLSTESPTGGAGTMGPPVAPASAYR
SGVPASRPRTPNEQATVTTAIQGSNGSKTQHKHSGAASRRSSISSFASELDDRFNLSRSE
YGFEPGTDPRMIQAITQTMIGEFLWKYTRKPGRPDFSQTRHRRYFWVHPFTRTLYWSTQS
PQTASKAQLMAKSVAIEAVRVVTDDNPYPPGLHRKSLEVVTPGRTMRFTAATSQRHETWF
NALSYLLLRANEEEGDFVLHSTPEDGPLDFNPSLNGRSSRMTDYSRRSAASHSSRAARGM
ARGYDITPGHESPSLSVRPPDTTMKAEQARQGSVSRLSSMFKTSGMMGTFSSRRSRYGGK
RGSVDDTSQEDSAEDLRRILERQEREADKIENVRACCDGKHDVGSLSRTSRFVNSRLSNH
SHS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]