dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSOPRP00000008445 (Ochotona princeps 76)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3126:68055:98800:-1 gene:ENSOPRG00000009228 transcript:ENSOPRT00000009230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 322
Sequence
WEAMAAGVRALRFCRVFPGGGAGCRCIATSPAAQLSPLELTARRNELFNKEKRRQLSLTP
RTEKIEVKHVGKTDPGTVFVMNNISTPYSCAMHLSEWYCKKSILALVDGQPWDMYKPLTK
SCEIEFLTFKDRDPGEVNKAYWRSCAMMMGCVIERAFKDEFTVTLVRAPEVPVIAGAFCY
DVVLDERLDEWVPTKENLRSFTKDVHALIYKDLPFEALEVEAKVALEIFQHNKYKINFIE
EKSSQNAERKVKLHRIGDFIDVSEGPLIPRTSVCSQYEVSAVHSLQPTQPNHVRRFQGLS
LPVHLRAQFTIWDKLLERSRKL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]