dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

LOC_Os01g40330.1|13101.m04126|protein (Oryza sativa ssp. japonica 5.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment DUF630/DUF632 domains containing protein, putative, expressed
Sequence length 685
Sequence
MGCTHSKVEDEEAVRRCKDRRKLMKQLMRRRVELAAAQTAYLQSLRNTGATLRQFAEVES
ALSQQPPAGIAVHPSPPPPPPPPPPPPPVPVPPAYSVTSSVPPYSMTSSLPPSPRPPPPL
PFSPIVIRRKKRDGELDEDDSTDDDDDTDSCSTPLPPPPPPGVEWEYLEPFAMRPLNFPS
SLADRIDKEAASQVTMDDDNWVETNTEFDGYDDESVSGNVEGIVSSVQLNQAKSRALGDD
NSSMVSWVTKDSDTSAMAWRSKKSLAGIAKEIDEYFLKAAASGSDIVILLDSSGGQPDPS
ELEANRGKNSKSAKVFSTISWSWSFKSAQANRQSSMHSSDASGYGYHGKTLEKLYEEEQK
LYKLVKDEEFARLQYRKNTSLLQRLESGDHDKLHAEKVRDNIEELQARIISLEEAVGLTC
LSISKLRDEELYPQIIELSAGLVHMWRNMYECHQVQNHIAQQANLLGNLPGNEPTTDTHC
QATSQLEVEVSAWHSSFCNLITLQRDYVTILNQWIKLTDCLPDNDGFMKSSSGIRSLCAE
LQRALTGLPEKVAAEAIKTFLSVIHTIVVQQTEERQLKKKSDQIESKFHTQLEKHSNNAT
QNSGQPTLAKLDTFKKQVEEEKARYLNSVRTSRAMTLNNLQTSLPNVFHALMGFSGVCVQ
AFEGISRCSEIVASHSGAVSPAISS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]