dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

LOC_Os01g64280.1|13101.m06919|protein (Oryza sativa ssp. japonica 5.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sorting nexin 1, putative, expressed
Sequence length 399
Sequence
MSQERSQSQSPRSPASAAGVPFLSISVTDPVKMGTGVQAYISYRVITKTNLPDFEGQEKI
VIRRYSDFEWLHDRLAEKYKGIFIPPLPEKNAVEKFRFSKEFIELRRQALDLFVNRIASH
PELKQSGDLKIFLQADEEKMDRERSYETGIFKKPSDFLQMFKDVQSKVSDVVLGKEKPVE
ESSPEYEKLKNYIFELENHLAEAQKQAFRLVKRHRELGQSLADFGKAIKLLGACEGDSLE
KVFSEVGSKSEMLSVKLQREADNLLFNFEEPLKDYVRAVQSIKATMVDRANAFRQHHDLF
QQKEYKGVNLEKLKFVNPDKFSELEAEVRELTADSEEATKRFEHIVAVMNEELARFQEQK
TADIGFAFHEFAKGQAKLAKDIADAWRGVLPKLEACSTS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]