dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

LOC_Os06g50840.1|13106.m05467|protein (Oryza sativa ssp. japonica 5.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment zinc finger family protein, putative, expressed
Sequence length 488
Sequence
MHPSGEYSPYYQPYPSPTSAPLATYPSASAPPYTPYPATDYAAPAAYPTYPPPPADPPQY
APPPAAPQPQPYYPYEPPPHNPAPSPYPSLDRAGSYGYGSGSQELYPPKPAGGGWSDDGV
YAYSGGGGDAPEPYGARGTAPRSNSPLFDDYGRSIGSTKERGGGGGGGGGSSASPKVVRA
VPKVETSEDTSGGVQKFRVKLLPEGAGSPMDVLCQVGLDGIRMLDPNTSRTLRIYPLETV
TRWDVLDSSIFAFWSKSSVDFEARRIRLKSNSYTTNTILDTVTAASVQFKEMGGSSISRS
RAIADAAKPPEQQNDRRKNFLDWRNLMKPMNEEKDHWVPDEAVTKCTACTADFSAFNRRH
HCRNCGDIFCDKCTQGRTPLTTDADAQPVRVCDRCMAEVSQRLNNAREAANRPIVHSHED
LAKKLKDAMDINKKSSSASSRSTDGSSRRMREVACPTCTVHLQVQVPTSGSETIECGVCQ
QPFLVSAR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]