dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

LOC_Os08g34060.2|13108.m03561|protein (Oryza sativa ssp. japonica 5.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment DUF1336 domain containing protein, expressed
Sequence length 763
Sequence
MATITLKPPATAAAAGGEVSEVELSEAGSPDVGSQSSGSGGSGRSTAGSSGWVYHLGVNS
IGHEYRHLRFLVIRGKTVAMYKRDPSKNPGIQPIRKGVVSHTLMVEELGRRITSHGELYV
LRFYNRLDQTKKGEIACGDPGEARKWVEAFEQAKQQADYDLMTRGVSWNRSQNENELNLD
GHRPRVRRYAQGLGKLVRIGKGPEKLLRQSSNLQSHEIINTNFGGDSGDAFEAHEWRYVR
TFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELV
ETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGY
ERTKINSSTWELRRLNPPGSSTPKCLVTHMLEMSPSFWDRWKRRHNENFDRSIAFALLSQ
VAGLREYFAANPALTSDLPSTVVKPKQSDSLIIQSELEDSELNDEFYDALARGESFEDED
SDDDDDMIPKAGKVKFKNISWAIAGLAMKPTKASVEKSELVTNSTPVTIDSNHFHGTLRR
AKSENDPNSWSEPGGEKFMIRGKTYLTDYTKVVGGDPLLKLIAVDWFKADERFDSVALHP
KSLVQSEAAKKIPFILVINLQVPAKPNYNLVMYYAAERPVNKDSLLGRFIDGTDAFRDAR
FKLIPSIVEGYWMVKRAVGTKACLLGKAVTCNYLRQDNFLEIDVDIGSSSVARSIIGLVL
GYVTGLVVDLAILIEAKEEKELPEYILGTVRLNRANPDSAVPI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]