dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PGTT_11784 (Puccinia graminis f. sp. tritici CRL 75-36-700-3 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | PGTG_11784 | Puccinia graminis f. sp. tritici predicted protein (1972 aa)
Sequence length 1971
Sequence
MEQQALLLPSPNIIHSTRPRPTPKPKQQQHTPIPTINTTPPYQKPSRHSEPQAQLSLPTK
PINRSRSSEELPHNRIRLLPNSSPSSPISSSFQLPLLPPKPKPTQPQQPTQQQQPTQTTT
NISQHEQPTLPPLSIHPTSQELSSPTQQRPTSNLSPNLSRNPSFSSPDVLPQLDLSSSIT
PSRTALISTTTTTTTTTEPISRRSSRRFSQSNIDPILHQQQQQQQPRKLHSRASTPLFTI
GNPDEKDDSRPHSAVSHLSTPSLFKRIKAGLTPKSSFASSSSPPLSTAIELFPDLTPSSS
SNSINPNLQLNNDGIQRRSSTDLQETVGYFDLSSERSQSDSMGPHQRQTMEELRGTTAQK
TSTTAMTTTTAGTKKKSGGQPSANNHPISRSFSQARIGSSPANRGASELRINRSLGPASS
FSPREYNREAFIDPRLRSSPAPSSLPSSSMPLTMTSVANTQRQQQQQQQQQQQQQQQQTA
ATPKVKRPTRNSVSNPIQPIIELTKKNMKKEKEPGRPTTTSATAISSTVGKSKPLERNPT
DESEEAYLSRLGALFEKSKIPSILASSNDPFHLSALTKYMSSFEFSHDPIDLSLRKLLMV
VDLPSETQQIDRVIESFSKRYTHCNPKLFTSPDQVYILAFSIIMLHTDAFNKSNKAKMSR
ADYVKNTRMDGIPNELLEYIYDNITYTPFVYVDPDRDISGQKITSQHQQTTEQHTSTSFF
NLGGHSNNITPILQSSSILPGTKESKSKLDPYHLIAKGSTHELRPDLGAVIPSRNPFSFT
GSVSWFDFKRLRDSFHPSKSVIIQVVNLSPTKIASIFKLIEAEELPSDHPADGSPSTSSP
LLRRNPTHDAAPTLSPLDSKSPALVASPIPSSSSNPVINPTFLNLRAIKVGLVHLKIDTF
TPFSTSPPPPLTSSASSSLSHSLGNHHNNGPASNSANSLNEISMSKNVINKKWKLFCVLL
TARQLILIKDVGLAGELQESIKLARFRNEANPEDQLVVRITGLKPDLVLSLDGGIALLDS
EYQRRPCTFRLVLTKDLSLLMGVDDHEDMNSWITHINYAAAYKTHRLPFWVTNRAESSPR
ASFTSRPTTATTMTKSNTHRIYQRAGLDGTPETINGMGRGANEDSAESLLSFSSSLRKTG
AHHHQYSQGGEKNETKARRSVDDHPILSRTTSFSNHHHHHSMIAAAARPFDLGPSLIGES
PRSSSTNSNRLSFLSSHNLPSHWDLVRAQIISLEGQIMAAKTELNEDLRLARNLAVLTPF
QFSTRSKLQLAIMPVANRVRNSRCQLSKLVCYREVLVRDLALGVALSNNGSGSTKINNTS
EKTGILMRKTGGSKEDGQADDPGQLIISSSPASCKPIPAQEFVIQTSDERRLSLTITSGD
RRSHPLSTLDTEDHQSASSKRGSDLPESSADPAPPPPGPSSNSTSTSLPVITDNRPIEIT
SRRPPESPPPAAAAADTATVTADPSDDLTSSTATIVLPSAVKNLTRNLLARSIVPSISAS
RHSSSSASVASKSPVLVDLAQNTNLSQPPLLDDHHHHQSQEEENEADNQKDDDETDDDSE
GGEGLASLCKVGRHIEADPNNPHDLQQQQPSTTTRIRNHEFMGRSTSKLTSQTDSFSSSS
PSSSWSRSTTTNTMMGRNRSGTSGSTKSIRDPQLQHYLHSSFIASHPHLLPAADNVSNPL
LPSRSPNHNPSHHINSPVPSSSLGSIGMNISSSVPIPLVSWSSSSSRTPLKASASLSGPS
SSSSAAAASTSTSTSTSAWRPPSSSSRPSSILTHSIFDPPTSPVSVSAPSGPPLDTPTSN
PPPHPSTHTSSSSASASASSASTTTTTTTIQRTRKRSAHPHLLTQLVPGSSSAVDRNAAR
ARMLLKARALEQSSGGLLHQKNSKKSSNGLADGGLVRSLEGAPPSTSTATATATPIGLNP
TTSSSSSSSSNQQQQLKDGGTGGSGRTTGSIKSTASFLGVSKKLHKAWGLP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]