dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|474980731|ref|YP_007691197.1| (Streptomyces hygroscopicus subsp. jinggangensis TL01)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment alcohol dehydrogenase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence length 569
Sequence
MTVDYADYVDAGEAVDQGTLNYKTPGGDVAPPVVAGVDYERILNARQEPHNWLTYYGAYN
GQRYSPLDQINTENVKRMVPAWVFQAGTTGLIAGASTYSFEAAPIVVDGVMFLSGWDGWV
WALDAKTGVEIWRYKHAVPFDVSLCCGNVNRGVAVAQGKVFFVTANARVLALDATTGRRV
WDKTYGDVRAGESATLAPLVVKNMVIVGSSGGEFGVRGHLDAFDLETGEHQWRCYTVPKP
GEPGSETWPADGEAWARGGANCWITGTFDPETNLLYVGTGNPAPDFDGEVREGDNLFTDS
IIAVDVDSGQIRWHYQCTPHDVWDYDSIGECILFEKDGRKLLGHFDKNGYFFVLDRTNGA
RVGITPFVDRITWGAITRDGQVTAKVYPDKEGEPVHFYPGPAGAKEWTHASYSPKTELFY
VPVQDTGATATRRRREFKESIPYWGAGVQVDIEDMAGSVSAFDADGEEKWRWRNELPMCA
STLVTGGDLVFAGEASGEFNALDARTGELLWQFQCGSGHHSSPTTYMVDGRQYVAVPVGW
GGWAEGFLPGMLGAGHGSALIVFALPEPS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]