dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|18312443|ref|NP_559110.1| (Pyrobaculum aerophilum str. IM2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein PAE1161 [Pyrobaculum aerophilum str. IM2]
Sequence length 100
Sequence
MFTVELYPALYLRAEGARRYRVNWYRVFGRSDFLWHPRHQFISRRHFAVGYEEGVYFVED
LGSTNGTFLNGVDIRGKGRARLQPGDVINVAGVLELAVEF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]