dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

1pnq_A (Protein Data Bank)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment mol:protein length:180 NAD(P) transhydrogenase subunit beta
Sequence length 180
Sequence
sghiegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsya
ihpvagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdps
spiygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]