dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

5e99_H (Protein Data Bank)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment mol:protein length:273 Fab F08_B11 heavy chain
Sequence length 273
Sequence
QVQLRESGPSLVKPSQTLSLTCTASGFSLSDKAVGWVRQAPGKALEWLGSIDTGGTAGYN
PGLKTRLSITKDNSKSQVSLTVSSVATEDSATYYCVTVYQKTTQKKNCPDDYTECYGGAC
DGTGCCSGSCGGASACRDWWPYRSICSSDNTYTYEFHVDAWGQGLLVTVSSASTTAPKVY
PLSSCCGDKSSSTVTLGCLVSSYMPEPVTVTWNSGALKSGVHTFPAVLQSSGLYSLSSMV
TVPGSTSGQTFTCNVAHPASSTKVDKAVEPKSC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]