dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|190571764|ref|YP_001966443.1|NC_010901 (NCBI plasmid sequences)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ORF10 [Lactococcus lactis plasmid pNP40]
Sequence length 846
Sequence
MNKNRGSQFRKWVLHLHSLYSHSQLSNQYNINENNHEERFDEFLKKLNENDIKAIGLTNY
FNFSEQDYCLKRKLEEKGIVVFLNLELRLENGNVKDETCDIHIIFDNLLDEKEVKCFLAS
MTAKVVNKRLDSISSKDDYKKAVVNFDDLVKCLNDKSLNLKNRYMIGILSRGKGSSRLSS
VFEDIAERCDFFIHSSDKQKNIEEDKEYLNSHGKPLLQSSDAHSFEKIGGKFSWIKADLN
FEGLRQIMFEPSERISLGKDNPDTKLDYQVIDSIELSDARIIYLNSSLNTVIGGRSTGKS
TLTNAIAKALGNEHFVPINEKTEKGMHVFDKDIIIHWRDGQEHQDLEFLPQDYMIKIAEN
DILRNNLVRSTVKSDEGNYRKIEKYEEDTRKNQNEIDNSIQEWSNLKDKLATLIKPEGDK
KGIEVQLQKLKEQISEQEKKSDFSERKSEEYRKSETELNYYLNHQRLSEINIRNLNDMGS
IEISLSTPIPSSDDTKFRESLEEYIEVLKTEVNEKWQQKIKELTDEQNEIFSENKLKVNE
IWNSEIFKQGQTNISNNETLRKLIEIQKQEQLKLDTFIKYENNKEKIETQINEIQTKILR
SYAKFGTLREKLQNEFEVKATPVEIKINFQPIKFEEKIKYLNGRNTTNNNFIEEFDKDSF
RKIDNIFDALNLSYNQGKSQNDLIKDVLSQHWYTINYNLQYDGDNFEQMSQGKKAFVVLT
LILEFSKDKKPVIIDQPEDSLDNRAIYNDLTNYLKEKKKERQIILVTHNPNIVVGADAEN
VIVANQHSEDSPNTHGIQFDYTNGSLENTYTKSMKYTLEKQGIREHVVEILEGGKEAFEK
REKKYK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]