dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|197336515|ref|YP_002157552.1|NC_011185 (NCBI plasmid sequences)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ATPase involved in DNA repair [Vibrio fischeri MJ11 plasmid pMJ100]
Sequence length 890
Sequence
MNGSTWKKWDLHIHTPMTHLNGAGFQCAISDYVSKLAAEELDLIGVTNYFYFKENELEIV
RDEIRTQTHRITVLGNVEFRIVQQNNGGEWINVHVVFSEKLTTTQINTILSSMPITNTSP
DGRVVYCSETSMQANGVRPDQAVVDFKILNAHLSGHLQRGTDYLIGICPNGYGGFRPDVR
DGRSVAIALELEKIGDFIFGSTDRDRTFFLNSSRFPNAKERPVFKCSDSHRLEDVGSQYS
WIKARPTFEGLRQLLIEPEARVQIEDDFIERTFAKPRFKSITANGSIIAGQPLKFDDTTI
ELNPNMAAIIGGRGTGKSILLDSIRSKFRHDPLGTNQARQINTEQFSLVLDQGNGSLLSF
NDVSNSYDYLHVSQGDIQSVSQNPEQLSKEIKKMLGLTSDAFNPVTTSVVEDALAKYRAF
IGYWSTSDERGNRINTDTYQNAIIADYQGLIATLTSAENQGLIDQYQANVAQVSKLTTYL
SKSAQIQALFTQQIDPINTTINEHNQSEFSATTIPSIDYHAAIAAIEANDLLARGQIAAL
NLSNQGIVTAFQSQGITQDISSLLGKVAEYQRNIEAAHEKLREIAARTAEYHQSIQGRCQ
LSDLHKAYLENNASAITTAFNSLLTENTAWTAEQNELVKEILSDISIFGAIYFNKEKFFS
LLLSKLNGGKFRETVTQTSIQRLQAMFPINTYKDFYRLISNEEMIVLSPDKTVTLEGFCW
ETEYFNQGGRFELLDFLYLPQNIQTYLHANAEFLYKDKTVTQLSVGQRGTFYVCLKLATD
PFGSPFIFDQPEDDLDNDFIMNKLVPIFRKIKKYRQVIIVTHNANLVVNSDAEQIIIAKN
DNETLTYQSGSVEDGSVNDPSSIRGQICNILEGGGHAFWLRERKYGLNDR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]