dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|289583606|ref|YP_003482016.1|NC_013923 (NCBI plasmid sequences)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase S8 and S53 subtilisin kexin sedolisin [Natrialba magadii ATCC 43099 plasmid pNMAG01]
Sequence length 1710
Sequence
MTDSREQLTALLLTALMVLSLVAIAGTGLAGSVAATEHSDAQSAVDADADGPASIDAELE
EASGTEQIYIVLDQYDGQLSDDRDRAIAQLQEHAEVSQAAATEDIDALAGVDVINDYWIT
NAIRAEVDTSAVDTAELAMIDGAETIQLRPDYEVPEPEPSVEPAVEPDEDDYTYGLDQVN
ASETWADFNTQGEDVKVAVLDTGFDIDHQDLDLYTEDADDPTYPGGWVEIDADGDPVEGS
EPYDTHYHGTHVGGTVGAAAPADDDTPAYGVAPNVDLQHGLVLPDGSGADSDTIAGFEYV
VEEMDSDVVSMSFGAGCGLTGPVYEDAWIPVIQNANDMDVVAVTSSGNSGEGCVGSPANT
YDSFSIGASNEAGDITDFSSGNTIAADNWDNPDPEWPDEWVKPDVSAPGEDVLSAMPDDE
YDYLDGTSMSAPHVSGVIALMLSANDDLTQEEIEETLEETAWKPDGEPDEKDVRYGHGIV
DAYAAVDEVAAGALEYELGDVDQDGDVTVQDVQLTQQYLQDMDPEPFAEDLADMDRDGEV
TTDDLSLLQQKVQGMLDEGEIDITGLDVPDEVDDGEMFEVTVDLENLGEEGAVQEVDLFL
GDDDEPVDTEVVDMAAPGVDDPIDHPAETTITFELDAGDLDGGDHTITVETEDADASDTV
TVLASNFELSNLDAPDEADRGDEITVSADVENTGNVDDTQAVEYRFDDLGDALYAQNVTL
EADEETTVTFDVGTENITEGTYDHGVFTEDDEATATIDILEAFFSVDITDAPEELAPGET
YNVSADVVNSGDAPDEQTISYEVTEGETDVAVVDGDVDEEELREELADRGVDDVDLDELV
EGADNLADTLQDELDDSYDVETVNADDLLDEVDAYDVFVVNDFDGADVDTFLDELADDQG
VIYLENWGSSSNAVSDLSDATDDPSSVEDGFSGSAPIMLDITDDHALFDGVADAGETIEL
HDASDADRAWFDGYSGDVIADVGDGTPDGASVGVSEDDDHVLLAAFGRSSFITNADFSDE
SNAIMANAVEHVDDYAGTASATDHTSEVVSLEPNESATVEFTNTLAEDDGELEWHHVVES
DDDIATAPFTIDDGPNWNVKGTVSDDVTDEPIENASVELEAGNETYTNVTDADGEFGLAN
VPAGEHNLTVDAEGYAAHTESVEVPEDDIVTVDVGLEELPGTISGDVTASDDDAPVENAT
IVAENDDGDVHEATTDENGSYELDGVSAGTYVVNVVDTPPGYEIDEIVTVAPGEHVDDVD
FVVDRTAGSIEGTVTNAAGVPIADANVIDADDGAFNVTTAEDGSYEIEDVTPGTNALRAV
ADGYDDSNVEFVDVETGETTTANLTLGTYFEVDDLAAPDTAEQGEEITVNATVTNTGEQE
DTRTVFYFPPGTDFGTDVIDYQPELAETVTLEGGESTTVEFTYEVGADDEPGEYEHGVSA
DEVESTFITIEGDEDDGEPVFDVSDLDAPADAEPNETVSVTATLENTGDDAGTQTVTYAF
DDETVANETVSLDATESTELEFSTELPADEGTYEHTVSSENDSATAQTDVEEAGEPEPAY
FEVTEHDAPESVDAGEELTVNATITNTGDEADQQDIFLFWDAAMSDLEDAESVAELREAG
IDSMESIELEGGESDTVTLTHEVDSETEPGTYQYTVSTLQEMADGEVTVDDAAEVAFPAD
PGGFDGAPPGAALGANPFENGIANGIGLLG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]