dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|513845203|ref|YP_008125072.1|NC_021526 (NCBI plasmid sequences)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Lp16_D013 [Lactobacillus plantarum 16 plasmid Lp16D]
Sequence length 861
Sequence
MTKYAKFYKCALQVNPCSYAKYRGETISDENSYNRELVRECETNEIKVIGLADHENAASS
EKLRTALKNQGILVFPGFEITSSEHIHIICLFSNDISTEELKSNLIFLMGDPNLKLNTTP
SKKSFGTIMEEVNGKLHGFAFAAHITSDNGILKRGQTSLAWQSESFRVAQIPAAIDEIEP
KYKGIIKNTDPAYKRKTPIIFINAKDIEKPADLRNESASFRVKMSELSFSSFKMALSDPQ
SRIILNSEYAKVYPTYIDSIKVIGGYLDGLSIDLSKSLNTIIGGRGTGKSTLISLIRYAL
DDEPSDKDNRKDLKEIISSNMGVSGVVTLGIKSNEQFDESFTIKRRFGQEPIVLNKDGNV
QSLKVKDIIPNIEIYGQNEIMSTVGDLEKKRKVVARLITVDKKITSKIEDSSRKISDNAK
QIKELLAKKDDYDEKLTELPKIENQYNTLTNQGVIEKLKTFAPFIRQQATFNSLKNNIYN
YQFTLPNLIGTDELSSSHVKALNHEITEFNSFLKEETNRINGKLNEIQLVYKSELQKWTN
EKKVADSSIKNVIQSLPDFHDRNPNELATVYQDVMTQRESLRPLKDKSATVSKELNELKQ
TRLNLIEAYKSALDEKNNSVNKQIKSLNKHQLNGKLRLEIQPQGNIQKLLDYLEKLPGIG
VAKLKGIADQSTVDVFTFTKNIRTESLETLMNTYHLTKMTADTLKKLNETQLLEIEDIRL
PDIANIQLLVGEKFKDIASLSKGQQCTAILDIIMLDNKDPLIVDQPEDNLDNSFITKNLV
DGVRHNKNSRQYIFATHNANIPVFGDAELIVTLHEDDGQGKADDDGIGSIDDENVKNNVI
NILEGGAKAFKMRENKYNIER

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]