dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|564287958|ref|YP_008874149.1|NC_023012 (NCBI plasmid sequences)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cell division control protein Cdc6 [Haloarcula hispanica N601 plasmid pHH406]
Sequence length 414
Sequence
MGMFERDTEIYLDRDALREDYQPENLVGRDTELNRYRAALQPVINGEQPNNIFLYGKTGV
GKTAGTRYLIDHLEEDAAKYEDIDLTVKMLNCDGLSSSYQIATRLVNEFRDETSQISTTG
YPRATVYDMLWTELDSCGGTIYIVLDEVDHIEDDSILYQLPRARANDNLSSAKIGIIGIS
NDFSFRDDLSPKVKSSLCEEEIQFPAYDAKELIQILQQRADVAFHDGVLEDGVIELCAAY
GAKDAGDARQSLDLLMKTGDLARDKDTDTISEDLVREARDVLERGRIQEGISGLTQHGHL
VVYAMVTLDQEGKTPARTRDIRPRYTNFAEKAGIDPLVPRRMRDHLGELSMLGIISAIER
NEGRRGGTYREYSLEMDPEMILAALEKTVDDVGIHKSVTNLVDSEATLSDFQST

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]