dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|76803438|ref|YP_327707.1|NC_007427 (NCBI plasmid sequences)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein NP6160A [Natronomonas pharaonis DSM 2160 plasmid PL131]
Sequence length 193
Sequence
MTSTYIKTKPERCCMTEDESDSEGLMERQTTGEDRVRMVARQLSEPQTANWIASEAGWSH
EPTKRVLERLVDDGILHCDESGTHTTYYPDYRRQAMQEAMRLRDSGHTVEELTDRLADMK
TQIRDWEDEFGVESPNQLRGTLADESLDGGEEDRRRDIAREWEHLQRRIQIVGFAIREWD
FLAPTTEPAEASS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]