dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|123476263|ref|XP_001321305.1| (Protozoadb 2010_08)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Trichomonas vaginalis G3]
Sequence length 5481
Sequence
MSVIRIYTSAGLDDPNPKYSTYSAQYTGDQFLQLACFNHGIQYNNTYVVRYMSRYGYEAI
LNPQDTLEQQGLVDDMHLFITWASETRPLPNYQQQVVPQVDYASQQMNVPNLGIPTLPTG
NNYQQQSSYFNFELPQFESGILPQGVPQYEEMPAYDPSQVPEAETELDVRIRNVESFDTS
VFETQTQLGLHENDSETIQAYTYNGFQENSLMPVTYCKSYTFQQVVSAATESLGLKYEDY
SILLCFSDDDMRWFDHNKYLEDYSVFSGMKFCIFPSEFQIKVESTAFNTNQYIISITDTV
EAIVKKIAQVENIENPSDFTLFKEETKTKDGKTKKSLVPLSLFQDLPHQCAEFKSLVFKR
RFFIFSAADLVSQSSILIAFDDAFDEIRSNKRIYIQPDVAVELTAYAYVVDHPDVQLDDA
NPPETKKHRPYAYKSDKSFNKQVNDFLKKNHIPDANNAARLFIRLARTQPGFGVIRFSCF
YEIEKVENECQTIISPHDFLIYHEQQNKTYVRIPYHSIVNTTLEEDVVTVNYSLQRNVGN
VSIRSKHADEIHDVINSFHSIQRNLLLERARLRLEGKWRGPVSEMDRLKLDTYNGISDKE
PVPIEYDKSFTGKMVLQLAMKELRLPVEKIDDYGVLCTIHTQRKWLNSDVTVGQLGIFEG
SKLYILTNKAKISIKFGDTDEKLFLDLTAPCKDVVTDIFKQIKQPYVHGYALFVHKNNEM
EPLDYKYPIPEQTLHFSTLYLRRRFFMLSKDDFASAQLSKIGYNDSREYFLHAKCEATDK
ELMELTALSLLIEGKDDACVQAKDFALEKWLPTTFKCKSDFKKNFVKYFPTYPRKDKEIN
YIRAYLKILRDVPFFGAECQDVKYRIIDTKLKKKGKFLDGEFRYCPLLVYLMDSSGKQVY
KIPWTLVIRTKIMKEVIHFTFCDATHHTNKDSVVTLEIRTNDMQRFQTMVDGSLNIYQQM
LKERQRELARQRAETAQKLAGGWTDQYGVIHGPMIDLMISQDLAVYKKSKTTFWIDLSAN
GEELVGQMSKYFQIEQKPTQVYSVVIISPDGSFSWLGPKETLLDVNPTRKSHLVILNTTP
LMKITSASNISKTIKLDITQPLKGLLKQIAAKYGISNFLGYTLFTPNTERPEEKLPLELI
KSIPEQTYNFDDIVFKRRFYMISRADFLDNRALWQTYSDIVELVLSGSMDLTNEQVAELA
YYQLIAEKNEKLEAKNVPEDLNKYVPKGMKLARSMGKDIKGFCKTMPIEDPNDARRKYIA
LARSIETFGSEIYQVQYYDTVKGKTVLKDCLLYVTPYKIYTCDLQKKEKYMCFEYCNLLD
VNQVEDMLSLAHCTNNGERLYDLFKSPQAALIKQIITSYIHIGMEILNNAIAEGLDVEEV
ATCYRITVLANYVLADNRNVQQSIALDSRLNGKQVSQRVTKLMGLHPRGEYACMLNFTKQ
DHKWVLDSELIGNLRPYENIPMSVYNRYMKIKISMDGVNYTYPAIDVTKPIKDLIPRLAA
HFDIEMPIGYTIFKADTNKPLDLRYTVPEQESIFDSFIFRRYYYMNSKYDMQNDFVVIKM
AEDFKAAALSGQGILNESEMLELAVYDIFMHADNPDLVKKMEFTTLDGFLPVGMISKPQY
IAKLNNLLATTPAMTAGNAARTYIIQVQKLNGFDRQTYNAKLADPKGDLPVHLSISSTQL
KVNFDTASRETISVSMKHVLNVQAIQDELYVRIESDEGESTVLQFHTPDACPIENKIIQL
IKVVIPELKIRESIAKVSYYNTKEIPVEQGEIPLIFAGRFNERRPRVIRINPNRTAAQVC
DVLQKHFFVKDLGYKIGYFSADFSFRFLEDDVAVRNVITRPDIVLYYMKPQTESYIESAQ
NFITKHKIHVSDPINTICQTILSQLGLGVEDGYTLYTPDFTPLDLQFSLPYQTDMIWDMY
LRRRFYVFTHQFFENPLNITSLYEDCKLAIMSGAIPTSEDLAAYLGIYSVYAQIPNVSDF
NPYLEKFGASSILPVQFQNSEVAQKKVDTISHSIVPVNNPDAQAKYIAEVCQLRGFGAEY
HDIEFKNAFKDWRPGVLALSPFAMTIESGGKVFDSIDYVKIIQYYPDEEGNMVIRYYNDN
NFINFVMIRSPRVNQVFTYINTLSHFMNEYGHLLTIDEIRAILLKLQNNPGAGVENYGFT
EDFKPSMFNLDVTDQGLNIDNLSIDDLNLNFLENNADYSTYNVDSNQPANVEFDLVDAPA
TIMNLYVDPSQFWIASPQGHSVSRSKKAIEAIEKNLKGLIDDFNKLTPTEFNARLNAIDD
MLALINPDDLSEEFRNEYLKLKEAIKQLRDLGRMIEQSDQELYRYKDQIQDLINQALASM
PTLKSQIDKKIVELAKTSNKNLTPVSRALIALTEQQDNLTLALINDLEKLKGLGFDTRAL
IRNLENSADALTRLAANFTDSTDPRVLDQLVIPQLEQMDALIKSIADLVLTANLSDKDLD
ALIRDLTGGTTSISSSLASFSNASKAAQGDLNKTLLNNRKAANAAMLTLIKAKKEIDAQM
KMLPADMQKEAKELSDLLARAAIELALNPNSINAPLQALDMLKLLLNKIRTKKQPNLKKL
DKSVDGVISDLEAALRAVSFVNIIPANVDKVIDDAMIMIRRFEAINADEWQARDKQSFVT
SEKAVADLKADIDAIETHIAALRKNMVNGQAQRLLQVDLLKLANELPKFQTAVDLIYKNT
NDGSFPVIIERLITDLDATLYDIPPLEDLDRCQHIEKYHNAMTAVANIINQTNRVMGLEA
MKKNPMTLAKLDAILEKVADLYTALVKDRAELHEHPFDKEAINQALRDLEKTAQTMNLMK
LPAAEVTEITRNNELSDAITEAVKSVAAAVSSLKDAPIKLYRLPPTRDQINKLNQALADY
IQMMSNLKKQDAIANNKQNAEKVQKEIDYIKQKMAEQKQLKPYDTQQFYHLLEKMYNRIE
RMPQKLNGLPHVSGPSPSDISRTTLPPLRNLLKAVVPTAEQATKDIIACIEPTEALIKAL
EALKNDKDIKKDKKALEDLESWIKALKAGDNMLKAVPKTGNTLQSLKALLGQLISLNNDV
QSVPSNLRKTIDKDVMAKLLDVLGLANAKISQAVICVRNIPTKGSVNADINLFQRLDQDA
ELDQSIPEMVQQFNDLSGLIKSISSIPQLGNRPHTKHLIDEMAALLNQLSIDVNAAKVDE
KKLLPVLTNSKDRLQTVAGNSELVSSIVGVPKLPDITKNVSSNAQTIARLLEKPHFNAAT
HKEFTTLILPQLMKLIEALKGPGYTQNANLPALAPLKDLPPTSQAWYDDLKTAKPGQAQR
ICDDIHSKLNNLIGLVMDYPELNDLANAIFNILDTTGKYTSASQSAGFATQLYPKTRAVA
PEVLKQALDAVADFLSGNTTNVPPNVLAALEENIGAIADKAEMMQPFVKMAAQAIAPLLS
SGDPLIAARAALLLALTSDNPEVRAAALEELSVRDFVRTANALNNLATEADMVTGAFNEE
IEYRLAYLKYAIAIADTKLLVKCGSISAAIILLDPMHNVQQACRLLLQSAERAGLKDFDN
LGGANKEYEQWLYESDLALSNMFNGQIDSLLVNLETALSDDQKNLLPKTVNKFIREMVPP
LKRKDRLLTIKWSDMADESNKYLAFTKNILPAIKSSGVVSNGREMAIAISDTINKITPAI
RMWSAMANKIDEPKFRNQTEADIGNYLYNAPQLIQEATVPQQLALTEGRLETCLHDAIWA
HELAKFEPKTKDKVENIERLISSLKQNMSNSPMVTKQMLNMLVDKLKEMLNQIIKSYPID
FSKQVVDDSSRTIDFDLITDKDCLAAAKIIKTELDKSKKVADSTKHIKQEKRKDGVKNIP
KSVIDIQSNPTGAPGIAALENLNSETTQQFELQARLAELMQLLLQLYPDLIKFLDNPQQV
AAALMQMDEGDIQRTAGEINNMLGLIADPEKFDKYAKNLSQEQVFNELLLLRHMTDSLMN
QPVKNSYNTREIVNWIMKNPSSEADPARAFQKMSAVEQLLQTLMALKFSAGTNNPKAAKF
ARTEEGMNVLRQNIPQHDLIQIQQGIAQQMGFASLPESLKIIQSSMSPEEVLLQARVINL
AIDILTKNADKLNPENMTQNEVLKELFQQQLAQSKENPNTFGNNYVDQELTEAALTYIDD
TQAKLAVFRAISQLAGPMATVPPKPIESNMKKALDAATNQVNNPSNETPKLSNQEKDAAQ
YALSVVSSPEFLKFVPPRKETVASSDTTMISSMTNALTPASGTELYLAPASSGINNSFTK
NDMVHNALVAATLFNNIKKAINAAKPNVKPQMKAENRAQALEELENFKQTPLKDYSSKVQ
QLKPDEAAALLALVEGSLASLNDAVTKLNGAGYRDSIFDRACLLAMQQKGTPDPLTAQKI
QELQAIAAKRRKEVDLASKIGKLLINRSNVADCTPASTMSNNAKKQSVDEVIKQMEMTLS
ALSSQLERFNDDELSNQQAVLISAGLLQHEVSVDNIADLAKLAVEQPLQRGSTSRVINSI
KYEEQQQNLLEKLINIAKKINDIIKDAKAGSYSIQEYAQAQDTIATMLGISDEQLGDYIN
RCPKEQLVIIAGQIAEIIGMLNKVEKKAITDFPVAIPDYDLTIRAQNETPSTHQLATAEA
NLFAAILRLLPSMSMVPVSECKSILATETQSAGVILTRLLNHKGSSYPVDASTLLQVMPQ
LCAAAIRVVSTLPESARKLIGCTPTDLAIMSARVSTTAASLSDPKASQECYTAIEKLLTA
IRALNAICAERGIELKSVDALANVKRSIDTKDIDEITMSLIDTRALNAAAASSNTKDAPL
DAVKQQLADVEGPSFELQAKQSPVSAELGKKLESIKPKLIEVITRYSEDPLKEIASIQNI
RTARDSLLDKRARFQTGVNGFVRSVTRKDRKLVKNAITDILTTVSTGESMAARSLLVTNA
NNPGNYSDLVGKFAMSVSSLKSIDELGGDSSTNPTAVRRTTRSLNRMIDSLIDMLEDAET
PQWTEKPKSAIDLAKLEVLKALTSTIQVLMGAVAAHNSAKIPETFAVSLQKCMPQLTQSL
NDLAKRADEIEKPNTDKNAYIAFKGDVGTFTHSINDLTNNLNNISMSGLLSKLLEVASSS
RNTLTSLNRLTDVEIEEPDLEAAEMLPQHFTMPPVPSDINATLAEQAQQLTKLANAAIDQ
EKAFFTAAAAKDNKKTATAMVNYAKAMKAAVEQILRASATTTTLSNQNMLTTGASNIVNS
FESLLTALRNRFLLRGDWANTSAEAKQSLENELSTAIKVVNEAVEIARREEAMNDAVTKR
LRAALKPLQTAASKVDSQLQAAQERPSSMSREWALQVLSLGSALSKATIKIMLHSKEHPS
ANSNKHADLGENVIRQLAKISADVEKILAGADEPEGIVIGIMDALAGVCQNVQKGSGIED
QALLEAFNIVLKTSRNVKATAEGIQEQKKAAKARAAAGGGVTSSAKKQSKPQLLKRLDLE
SRVIRARTILERYEAQLNELQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]