dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|156097616|ref|XP_001614841.1| (Protozoadb 2010_08)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Plasmodium vivax SaI-1]
Sequence length 1856
Sequence
MRLAFVLPLPLPVLPLLLPLLLHLCQAFNWKNLHNVHVTTRECALSLIALAEEAERIRLG
KRNDERMAQIVEEMKKERQTLQKLYFSIRHLFSSLGLTFTKELYLFGGDGEKAKQGAKKQ
EDNPSGKRFTDEQHLRGVKTERDLKALLGEMISYYKKEFIQRKAATSCSYINRKNSLRKQ
IEIVRYTHSYVATKLYYREYAKYFQRFLGSGRGMASVLSNPALDIKEGVYSGVYANYGGV
IAGEPKDGPKGKPRDGSTDESQNGPRGRPPTCSDDYKSISGEQCTRQFAQSVKTMLHNFE
TSLQSYIHSSVVEMKKQMIQVEEQQEGENYCRDMEEELKDKSYDKISMAEIERFEQLSKN
YLHKDLDALVQREKKKMYRRRNFFERYFFFIIERMLQVRRGVEAALGALSREPATAPSEP
LTAAKGPLSRGPPIKRTFQLLDEYISMYSFAYEHLKDYHLNVRDLFSLDYIRENSKDNRA
YIAERIAQKMDALNGSFLKYKNVKNRYEQCVEKGIRRSTSMGTLKKGESVSGGGKNVQGR
EFPELWASTWERSSHSFLSEEDKGKKDKLNGELIEREDEYLRRLQNVVKLLSRYKKLKNK
KVKIRHIVNIGKVEMHPILFNLKLRKDQMVGFYRSILHFGKIFVAKRIVLTLKMKLAFLG
RVTPSAFLLSNRFLLLLYETHLGHLQSSYKIGVNKNFCHDLTLENLDGVMKQGDLPHLLL
KYVIYMFGLNSAYMSEHLGGDLGPAVGSSDYIGGSNAANGDANFGEDDPPWGAHNLRVVY
ELARNFTKRPLIHAADFFQSGRTSPNGESNTHDEQVENAFRQMHSYFSSIFNSDEISGHI
LKQFESWEERSSSGCYEGHSCSMEIPVYSKDVIRKSIFYNLHGMGDEFDVLSEATVSSVS
SCATSAYSYVSSAYSYVSSPYPYATSPPLKFPSHLLTNAIITNSLSEAYKYMLYKTQQSQ
AFKLYSRSKGTNITLLETVFLQLILNFGMAPYNKLKGTMVSRFCRKKGRVQEDETSSKTL
VGSFQYGKRKRNFDFIPHIRYVPKGEQLQAGLAISCSEMKQIDGNASHKKTPTKWWNTKR
GSNYSPPNNSTSSHRMHHLGTCELLNGDKQKMTSFEVQHVEYIPNGMAFFAPVVERQNVM
SDYELYGLFFQGARWGEEEQQQEQEQQEQQQQKKRNSPEEGQTEQKRENTKEDIYCSEEK
LAYFFIGESVVYPSEAEDVEEPLIGPILSKSAASQREILFERESMEQYNMILNWLYRSQE
KKNWNREKVRKIEREISVLRGRAKLYEENISHVRGKMAQMRRPPGEGSDLQREYQREVSN
AAREKYNSLMEIYEDTVELFRESERNLTKVKKQNEREGEKVDAEEEEEPGVDYYGLRKYA
LLRKHQVEDLNMYTTYHEQIMKYFQKQNRCCDAYIKEMTIHLQFFPQVCCPREGERQNEE
MLKYIYISITDLVTDFVRCENNTNRLLTHLKKVKDTLHTINTVNANLHKKKRTFHLSTKY
FYREKKEENIYFFTDKVENVKTYKIYRQLIDSVNEDLLFITHIMGKKLEERKEVLQQVEE
KVPTLLDIKRILYADKEVASIHVETLCANFSHENMINYDKVKILGKNFKKKIGMYKNVLK
NIRYSFENEPQVSNDNLALFYNFVEYDSEVDTDAMQFADALLAYNEGGVEVPDRGEDAKN
AGGRPLTMYQEIWRKLNAPKGGGEKRAKERHDDGGDDPGDDQEGDSDRDLYADWDEEDWE
EDSLKAAADRVEKNCRNRKCPLNSFCFIQTINEECLCLLNYSMVGEKCILNEQNSCAVKN
GGCDLKATCELKKNRVNCICPKGTKPMHEGVVCSFSFASTLSQVLLLFAILAFVTA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]