dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|193809870|emb|CAQ40574.1| (Protozoadb 2010_08)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Merozoite Surface Protein 8, MSP8, putative [Plasmodium knowlesi strain H]
Sequence length 476
Sequence
MKKNAQIIIFFLFGLLSCTCGAEGNVNPPNNNGNKGNGNDNNVPTFIGGNNNNVNDNGDD
IFNKNGKDVSRNDGNHAENPNDKKNENGSGSNEKNSVENADNGSGKSDANTNQNGEDANK
VDEASLKKILKIVDEMENVQGLLEGDYSILDKYSVKLVDDDDGETNKKKMIGEYDLKMLK
NILLFREKISRNCENKYITILPELLKKCSNVDDPKLSKASEKIKKGLTKNNISIEDFVIS
MLEDLFDKINEKFIKDYSFDLNDYLIDFELINYIIMQDTSDLINDLLNMLKSMNFKLESA
SLDKMVKNAQSGMNLNSKMKEDIIQLLKKSSAKFFKIEIDRKTKMIYPVQVTHKGATMKQ
FALNFLEKNNVCEHKKCPLNSNCYVIDGEEVCRCLPGFSDVKIDNVMNCVRDDTVDCNNN
NGGCDVNATCTLIDKKIVCECKDNFQGDGIYCSYSIFNSINNFIFLILLLLCLYLF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]