dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|254832737|gb|AAN36075.2| (Protozoadb 2010_08)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Antigen 332, DBL-like protein [Plasmodium falciparum 3D7]
Sequence length 6093
Sequence
MSNINNKDSSTEWNCKEDVGCVPPRRQNLNMERLDNENEDSVPDFMKKTFYLAAAGEGKK
LREKHDESCDEFCDAWNRSLADYKDIFQGKDMWNDGKYGEAKNHIKNAFGDMNNRKTMLN
EIEKGIKDETFSRENGLDVCKSQCEERSRDDTEDQFLRFFAEWEEEFCDGLNKHEEQLKS
CTKDINCDIKCSNFKDWLETKKDEYDIQSRVFEKKYANDNKSKHLNYLKEGMNKCKVKNP
EMVFKSGFANVAECRNLNVEGAGNKNSNNLKDLDSNSDKDGIVSESYKATKKNGESIMDR
IPKSFNKLFGYFSGSQEEEQKENDVSHRNNYDNILVDKFHRSSLLDKLDDRMFFDELNRD
NIMEEVLSKIPEPIIREAPKYVPKKPVPPQHIPRGDNVPRNIDVNGSKDEYSPETESANS
KIKPTYEENDEDKSKISIETSEIDRDKEPFRISEEKKVVKEDVQELENIEYEFDETFDFF
DEDAKRNIDDIRKDIQSQIMKSVENYNSEKEEFKRNIETQLIESGDGMNAGNYSSALQDN
STEIPTMVLVPGVLTVFLLTIIWVLVYKHSLIDRVHGTGKTKKEEKMKELESEEFPKEKY
NIEDMEETEKENEIEKIMDENKETEQTEEGNTEEFVQEKELNQETLENEIIVDHIKEEED
TRNVKEQESVLEESPIEELPVENNIGKINEEVEEFILNEIPLEEQVPKELPQEEIEEIVV
EELPIDEHLSSEETTVTEEDTFKGQLINEEKPVEEKSVSEEIPVEEKSVSEEIPVEEKSV
SEEIPVEEKSVSEEIPVEEKNVSEEIPVEEKNVSEEIPVEEKNVSEEIPVEEENVSEEIP
EGGIAIEDVPVDEETVTEEITVDEKIYDKLPNEIETVNEEMPVEDETLTEQISSEHERVP
EEIIEEKPFTEGEETESLTDEIVEEGVVTDDIPEEQIITEKVQEEEEFVTGELSEEDIIN
EKVQEEDESVTEELPEEDIINEKVQEEEESAYQEIVQDGSVTKDVEYKELVNDDVRDKEN
FVIEEDPFKGQLINEGLPVEEEFVTKELPVKEESVFEELTEEDQSVTKEIPVEEHSVFKE
VDEIESVTDEIVEEEGSVNEEVEEEVSVSGEVDETEYVTEEVEETELVNEEVLKEEGSAS
EKVVKEEGSASEKIVEEEGSVTEETASEEIVEEEGSVTEESSSEEIVEDEGSVTEESSSE
EIVEEEGSVIEESASEVIVEDEVSASKEIVEDEASVTEEVVEEEGAVSDEVQVTESVEDE
IINQGIVDEVIVEQEASVTDEIVKEDESVIEEIAVEETVTEVVEETKPMDEEIVDQGSVV
ENVEEKKTMDEEIVDQGSVVENVEEKKTMDEEIGDQGSVAEKVEEEELVTEEVIEREGSI
NEDIVKEASITEEVEQIEPVTGKVEKIESITDEIKEQLVPEDIKEEQLDFEEIVAQRASV
NDEKVEVASITEEVEEEEKSVSEEVLEEEGSTTEKVVKGSSTEVVVEEQGSVTENLLEEE
SASQGIVEKEEFVDEEDSVKDQNVFEKEGSVTEQLVEEEKGLINEDNEKEELITEMSEEI
KSVNEEIEETDLSTEEIIKQQGLATYEFVEEEKSLTDKLLEEESVTKEVGETELSTQEVV
DEKVSVTEEVIEEEKSVSEEVLEEGSATEEVVEEGSCTEVVVEEGSCTEVVVEEGSCTEI
VVEKGSDTEIVVEEGSATEIVVEEGSATEVVVEEGSATEEVVEEGSVSEEMLEEEGSATE
EVVEEGLSSDNVQKSKGVIENVGEIYSVKTAKDESMNEKIPLEKSSFVDDESFKGQGPTD
NVSVEDVNSEDIINEHTPLEETKIEELPTEYITTADIHTKGETETKYNLIYEKINEEVEK
AKFQEEKITENIPVERESVTEDIVQEPSLAQEVEQKESDTNEIEETKLANEKIIPEVSVT
ENVVEKEGLDTEEVLEEDESITEEIVEEEVSSSEEIVEEEESSSEEIVEEEESSSEEIVE
EEESSSEEIVEEEESSSEEIVEEEESSSEEIIEEVSSTEEVLEEEGSVTEEIVEEEVSTT
EEVKDIGSVSEEVLEEEGFGTEEFVGQQGSVIEEIVETESSTEKVLEDVGSNVEEIVQEE
GPVAQEIVHEEVSTTEKHDEVDRSTTEEIVEKVGSVSEEIIVEEVSASEEIVEEGSVTEE
VVEEEKLINEVGETESVTEEIVQKEVSDAEEVLGQEGSMNEEILEKESIVEEIVGPEGSV
TEEIVDHGSFAEEVKEEELVTEEAVQYEGSVTEEIKEEESITENEAIEESAFAEIIEEKG
PNTDEIVKEEGLDTEEIVNEVSVTDEVIEEEKLVNEQIVGEERSVTEKPVEVERSATEDL
VEEEASVTEKVSVHEGSTTEQILDESVAEEIVEEEVSVDDKIIEEEVSVDEVVEEEGSVI
EEIVEEEESVPEEILEEELSGSEEVLEDEWVTDAFMGQEGSVIEEIEEIVDGEGSITEEI
VEDGSANEKIVEEEPSRVEEVLGKEGFVIEEIIEEGSVIEQVEDTKTVSEKSEESSAIEE
VKEVKEEESISEKIVEKEESVTEEIVRQEESTTEKIVKDVSPTEDFVEQTDSVTEKVIEQ
EGSNTEVAEDVEEKESASDEHEQEDVSVNAQVTYEKKSVTKEIVDEVSRTEEIVEENGSV
TEGVDETGSVTEEIIEEATVTEEVVEDGSVTEEVVEDGSVIQEVVEDGSVTEEIVQENGS
VTEEIVEEEGSVNEEVEEEVSVSGEVDETEYVTEEVEEEGSVVEEIVEEEGSVSGEVDET
EYVTEEVEEEGSVVEEIVEEEGSVSGEVDETEYVTEEVEEEGSVVEEIVEEEGSVSGEVD
ETEYVTEEVEEEGSVVEEIVEEEGSVVEEIVEEEGSVSEVVDETELVNDEIVEQAPFTEE
VEEQVSVNDEIIEDASVAEAVEESESITESVSQEEETEKGFVIEKVEETGAVTEEIVQDG
LITEEILEESESVNGEIINKESDAEEILETEFLTEEVVGQAGSTSEEIVEEEGSVTKEVE
EKESVTEELVDEGSVTEELVDEGSVTEEVVEQGGSIAQEIVEEESATEEIIRDETNVEEV
LEKEGSATEEIVQDGSGTNDFVGKQGSVIEEVVEEEISTTEEKLKEEASAIEEFVEEESI
REDVLEESLVTENVVGQQESVTEEIVDGEGSFTEDIVEEEESVTEEIVVDEESVTKEIVE
DEELVTEEIVEDEGSFTEEIVEDEGSFTEEVIEERSLIEEVEDTETVAEKEEGSVIKEII
DEKSLTEKIVEEEKSVTEEVEEKESVKEEVEEQRLVVEEEGSATEGIVEDRLATEGIVDD
ILVTEEIVEDGLATDEFVEQQGSIIEEVLDDEGSVTEEIVEEEGSPNEEIVEGVSVIEED
DNIEPVSEEIVEGSVTEEMIKEGLENEVILDEDSITEEALEKEGSVSEEIVEEMGSLTEE
IVDEERSTSEDMIEEGSASEEIIQEESQVEEVVEEVSVIDEIVEEDELDTKEVVEEIEFN
TEEVVEHKEEEGSVAEEIVQEEKEGSVNEEIIEEVGSITEEMVEQDVSDNEEIVEERSVI
EEAEENVWIEKEVEEEGLDNEEVIDEEDSVSEQAEEEVYINEEILKESSDVEDVKVENEL
MNEEVNEETQSVAENNEEDKELDNYVVEETESVTEEVVVDEVPNSKEVQEIESIIEEIVE
DGLTTDDLVGQQGSVIEEVVEEVGSDSEEIVEEASITEEVEKKESVTEDILVEESVTGDI
LVEGSVTEEVVGEEKLVSEEIVTEEGSVAQEIVEEDAPATEEIDEIESVTEEVVEEEGPV
DEEIVQEEGSVTEEIIQGESKVEEVVEEQGSENEEIFVEEVSASQEIVQNESGTEEILEK
VSASQEIVQDGSVTEQIIEEQKPVTEEVVNEEESITHEIIQEESHVEKVVQQGSVAEEVV
ENPVSVTEEIVEKEGSVTEDIGQEGYVAEEIVEEEEFDNEEILEEESVAEEFVEEGFDNE
EIFVEQISDSEIVKEENSVNEEVLEEEGSYTEEILEEEGSYTEEILEEEGSFTEEILEEE
GSYNEEILEEEGSYNEEILEEEGSYNEEILEEEGSYNEEILEEEGSATDYFVGQGSDNEE
IIEEGSATDYFVGQGSDNEEIIEEGSATDYFVGQGSIIEEVLEEEGLDTEKVFENEGSAT
EFEETESFTEVVEETESVNENILEETSINEVQKIESITEDIKEQLVPEEIKEEQLDSEEI
KEEQLDSEEIKEEQLVPEEIKEEQLDSEEIKEEQLDSEEIKEEQLDSEEIKEEQLDSEEI
KEEQLVPEEIKEEQLDSEEIKEEQLVPEEIKEEQLDSEEIKEEQLDSEEIKEEQLDSEEI
KEEQLDSEEIKEQKGSVNEEVVEEEGSVTEEIKEQEESVNEEVLEEVEETESIKEEIVEG
GIATQEIIEEESDTKEVVEEEVIDSEKLVDAGSVTGEVMPEEVSVTDEVVEEGSTTEEVL
EEQKSVNEEVVEDGLTIDDFVGLQGSTTEEVVEEDGSAIEKILEEETATEEIVEKQVSVT
EDIVEKEGSVNEEIIEEASVAEEIIQGGSFTEEIVGQEESATEEVIDEEGLISNEIEEEE
EKSVTEEMIEEVEEVSVDDEVEEVSVAEEIVEEELVDDEILPEELSATEDVIEEVRSVTD
EIVQEESVCEEILEQEVSASEEYVDDKSVTDDFVGHERSVIQDVENTESVTEEIAEVDKS
VIEEAVEKQGSVTEEKVQEGVSAIEEIEELESVTEEIAEEDKSVIEEAVEKQGSVTEEIV
EEEELDTEEVLEDKSVTGDVVEQEGSGKDESEAKESFTEEVDELKSVKEEDQETEYISRE
IEEESATEQHSEQELSINKEVVETESLTKDIEEEKSTTQEILEETQSVNEEIVEEERDTD
EVLKEKVSPSEEVIEEQASTTEEFVEERSSTDEIVEVEDLFTEEVKEREGSVTEEIVEEG
SDTGEIVEEEGSDTEEILEEGSFNEEIVEEEGSITEEILQGSVTEEILQGSVTEEFVGQQ
GSVIEEIVETESAIEERVEEESATEEVDERESVTEVVEEEVSSSDEVVEGSIEEVIENEG
SVTEEILEHEVSADENFVGQAVSVIEEVEGTESVTEEVVEETESVSEEIVEVSPTENVVQ
QTDSVIEEVVEQKEGSFNEEIDIRELGDDGVEEREKISTEEVVGQDKSATGDVEEVSSTE
DEEEVSSTEGLEEVSSTEGLEEVSNTEDVEEVSSTEDVEEGSVAENVKETKSITEEVSVE
EDIITDKVSVEQEVMAEASVEENILTEVPVEEEIMTEKLSVEDKALNEKIMSEEEIVIED
GNVHEVVPAEVSVTEEIPGVEETTNNESHVKGENVVNEVVVDDNSVNDEIQFDDDSSIEI
YTVDSKDVFHKEENYDSFREEVRSDENIHIFRKKNENFVKKIENEKSSVGHVPTEYTSKE
NIAEEVPSHIMFKENVTEEVPKEVKYEENTVEEVFEEVTSKENIIEEAPGDINSEENIIE
EVPEVVTSEEIVVQNDVNNINTNIDHMFDFDLDDILKIPEAQRKLNKLRTLVDVHLDVIE
KMQRDEWKKNKRDFLYICLKEINKLSEDTLMKFYGSDSNKSANDNDTVMVIKILKDKWGT
GRIVDTIANSLNKSYNSLYHNLYIEMEKDLLINKTETFNKWSKQHWNKLDNWKEEKWFKL
FKRDLKIDMRNTYESDQNDEENNEESMNELSDELIKNNTSDNMRNEQKTLEKNKEYSNLS
KDLGLIEKQKIIWKSWIVKNVNNIENWFDEMWFKNVVNELKEKNDVSNVLQENASEASVE
NYISDVEDSKDMTNSINDSEKSKIVASSSKTTNEEYIILSRKDLIYNIIVMVHMMVLDQF
KYDELKYAKKRFLNRSIDKFIKEKKIKDKETVLDYYIDDIIKRIVEDTSHVNNIKEKAID
HYTSHDWFRLLRQGNKAQNSISQEVDILTEKYKKLISEEDNKKENNNNNDDEVKPELKDN
IKCEENVSFNILRRSNKKDQLPLEEKKNKNGDLNNTLTESDGKKININEAIEESKNGNED
KNSGNMEKSRKPRDRRTERKEKDQDLRVQLLQDYENIFEQIQNMENQNKDKNKKETKNIL
KTSIDLDKNLLREYKKEKNIINQSEKEFSVNEN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]