dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|82794512|ref|XP_728466.1| (Protozoadb 2010_08)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Plasmodium yoelii yoelii str. 17XNL]
Sequence length 213
Sequence
MKITNYLSIINLFVVLLISFKNVHEISLINTKKYQRNIFCAKRILGDPPSANPSTSLNQN
EDNHNSNPDANKGNTNKSDKLNGDNIPNSQSKSENTNLSESPKTGTASNPPQPEPSVQPG
NTNGDSQNSIHSDDEEEDDEDEDDDEEDCSVNNGGCGENLLCEKMESGIIKCSCPSGYKL
NGTSCIELLSAHSVNYCFCGILIILIILVSMIY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]