dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|407465680|ref|YP_006776562.1| (Candidatus Nitrosopumilus sp. AR2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GHMP kinase [Candidatus Nitrosopumilus sp. AR2]
Sequence length 304
Sequence
MEATAFCPAHITGFFKAHLEGKHYNLENLGSMGAGFSIKEGVTTTVKVQAKDNQGSNFKI
TTKGYQADKTDVSQYVLNEFLKLGEFSTKFFDIRHEISIPVGYGLGSSSAVALSLSFALD
QALNTKLNKTMIGQIAHNAEVSCKTGLGDVLASYYGGFEIRIKPGAPGIGQVKKITTDKI
SVIMICFSPISTNKFIKERLSQINGLGGKMVNKLLESKNYEHFQDMSLEFAKYVDVMTPR
MQKIVEELSENNIKCGIALFGETIFSMIPQKIESKVLEILQKYSNDGIIIKSELDDIGAR
VLNN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]