dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|427712353|ref|YP_007060977.1| (Synechococcus sp. PCC 6312)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Syn6312_1252 [Synechococcus sp. PCC 6312]
Sequence length 380
Sequence
MVVKQVRNAIFAGLSGAVVIMAFANNLHDVAQRWWPNPFQDSLSPDTNPHLNAIAQAADT
PPNPNLLDRLQALTSTPTFYVAADGTDQSDGTANAPFPTLSQAITAVTAAQAKEPQAQFI
IQLAAGTYGDANTSEPLLIPPGVTLKGQGTATTVKQSLQLSHNSRVEQLVLNETGILIRP
QENATGEVSVEQVSITRGFLTIKAAGPLPTPKIQVKHVTMADSCILVSGVAKPEIRDVQM
RGNVGVDDFSLAHCSENGLLASGDTMPLIQLLGAATLENILVSNTNLAIFNQSEGSVIKN
LRIVNSLNGIENRGNLSLDGPNLENVSYTGICNHGSLTLQRPGFDPTTAITTPQCLVPGL
DQPPPSPINLAGNLDTIKVN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]