dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|221124030|ref|XP_002155751.1| (Hydra vulgaris)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: fibropellin-1-like [Hydra magnipapillata]
Sequence length 621
Sequence
MKSNSLETGTVAELEVLSSKLLLFERDPHPCEPNPCNHGGKCSLKKSIHGYECECPSGWK
GFNCEIKDRCSLSTNPCMHGGQCIGMDDHIECKCRARFEGPLCEVDKCADCHQYAFCRHG
HCVCKPGFVGNGFKCNAMGNTCQPNPCDNGGVCKSGQDGKIFSCECKVGYVGSRCEYPNP
CSETPCLHNGLCIDESNKKERGVSITGIRDFKCFCMQGYRGKFCEEIDLAACSSSPCMNN
GTCFDSSSESHKLHLKHPDDYECFCTRGYAGKNCEIKRFPCELHPCENQGTCLDSDNLPF
VSFDAHGYKCNCSKGYKGRNCEISIKTRGPCYYSPCLQGGRCVDFMNNNDPDLHIIDEQE
FKCYCKPQFSGKVCEVPYPACSSFPCYHNSTCVDGTIDPTANFDDTGYLCKCTSGYDGKN
CERQYTSLSLADIGQADSPSEFLSQNQAGAKHENSITGFKGDKAVLNERNVFLKTRDSQD
LKNEFYKNQKQELTSASNNAGQSISQHPSLTQLSKTSKDAINKVKYLNLYNERGNPLLNP
APTSPLVLKKEVLHYPDTNEDNVLHEHNSVERVGKHMTGSVRTFERAATPYDDSTKLATR
GLTASSWPVLYNDWWNNETKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]