dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|449671223|ref|XP_004207449.1| (Hydra vulgaris)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: uncharacterized protein LOC101241166 [Hydra magnipapillata]
Sequence length 599
Sequence
MVVAVQVLRLLWISLMLVSHTKECIKLLNRNWKQKTPAERTKDAEFVLTAKILYTTPSPR
YPQFYSATFEVLNVLKGWELIKRLHNKKSTSIISLDPKIIATANGFSDSFQLCFSSVEVG
KTYALFLGYKRETYELVAKYDDLFGAAEQLYKRTEKDILESLGWRSWNAWTSCNKQCDTG
IQTRTRSCLKESHSFCHGLSEEKRECNTFSCLTSKDALLIMKNLREESKIFADQWKARDE
ASSNTKKKSDVLSAPFNFLFPDQFPISNVLHITFKGPVKDSQFIFSIYSANNKMIMGIKV
SPFQFTIEYDQVINNAVNIRHSNPFHYSFIQEMLYTLAFVMNHENVRFSINCEELHISSL
EDELFRDADIFGSIFIGAGEDAGEESIPKVEVSHVSFSSDSESRWRQCGKIILERPQRSY
DAKGSGSDILNDGSGANNFDGDDENDDDDYEDNFDDDYNDEDEKESKNYKKTGSGNGKEC
LCQNNGKCKEDGTCTCQNGWNGDLCELPTCENLCLNGGTCVDNVSCKCPAGFKGARCEET
DKCRRYYTKLVTYSKLLTQYVEKLETIPCTDNENTLCTRKRLVSQVINKVFYRPEYVCD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]