dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|449676835|ref|XP_002155905.2| (Hydra vulgaris)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: neurogenic locus notch protein homolog, partial [Hydra magnipapillata]
Sequence length 447
Sequence
MTNNNIKQELTTTTLEKDLGILILNDLKWKLQIKITSSIANYKFEFEKQVWSPYFEKIIN
ILEKIQKRVTKSVPELRHLSYSERLEKMKLTSLKQRRTRGNLKQMYKWYYDIEKITWKIP
PQHSGPCSNIRVEQGIFPQTLKLAKVKPILKSGDIENIDNVNDCKSSPCVHGSCEDLSSD
YKCKCSKHWSGKNCSINISHCTESLCSNEAKCFSEDDDDYICICKKGWGGKNCTIDVTDN
CISNSCLNNSTCQDLVNNNTCKCEKDWKCINWEIDGFPCANDPCMNNGTCQSLNGDYMCL
CKEEWSGKNCNTSFCSNQPCKNAGRCVNIEKDYKCECAKNWQGRNCDVYFECFPNPCLNF
GRCVSLVNDYHCICDNQWTGKNCDKKMSPCSSLPCNNGATCQTTGNDFKCMCKPGCSGRT
CDTQTLLCEKINYSNNGICTEIENDFK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]