dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

SCRT_00413 (Saccharomyces cerevisiae RM11-1a )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | SCRG_00413 | Saccharomyces cerevisiae RM11-1a sporulation-specific protein 71 (1246 aa)
Sequence length 1245
Sequence
MDSIVNVVEDDVKYAQRVTSFSSPQNANVKVFTIPRHSFTAFRLSYVSPTELSACSQVTL
LGGIPKQWYADQNNQVWKLLTKISLRKVRKQSDMLRRYGYGTIYKKRVGKIPTALYLRKH
FTWSYEDNTSIHNGHRLKEAEMEMKRTRSSPVQKSEYKLSLPRRCKSSSDQNFMRQELLK
EKKSELSRNNSLPLIDTAQAVDIHPVLHEEDQENTNKRNKSLLSNLKRKDLGESKSISRK
DYSHFDRIPSPSSARSVGETDFNYNREPSEDTLRYPDSIIEVTNRTSPAPNSILSRSGQF
VNSNDLSDGFSTSNTINNVGLNANEKIFFNALQSMEKENLMLWKTSQKYGTYLDERRKSA
DAFQKRERGSCVDIGKLHSSHLPFINILPPWPTELTEEERIIHDRLASKHSHHIRKHVHN
ARNKTSCKIKDSVGTFLGMTNSLTNKATVKKRTGQILKKEKMLVMVKEAIQNKVPLPNFS
ENECFDTRVSERWKEYIVIARSTGRFDPPILLQFYRHRHIPEIEDISSIATKYHRNPLDF
FLSRNCIVKFYSSLDKTISIQKPDKRLGGFIDESIEKKDELKHYSPIKIFILRCSSIRSS
GRWYKFLLESLDRQLFTPAINLKIPLTEISIKINLNEIIFQKLIDLGKQEKDRLKICFLQ
RGYKIFQHPILRYFTVAILEKLKLAHYDYLIRKWDTENPVLGCALKRYDRLEWIPCDEDS
LVTGIFAFCQSHLIQYRPIANRLRETKSLEGKCLKEPTPIEGFLIRLTDKYGSARTNFGK
YSISTAYFFTCENLLFSMKAYRANPPLPIDSMIDDTSTEIEKEEIWKQWKKIPEVYEQQP
YPLDTNDHIEWMNCQTTQSEYDSRDFYAFHCFHRRIDQILKTDNVIDLTEVKDIYQGTRT
DYEADKIKYGVYKEASEIFWHRNYEIDDVSRSVINIETSNGLLLKLLATSATVAEEWVIK
LKQMISYWKNKQREDTERLLKIRRSNAGLLMLNGEEETKIGENTLRWIVEHGRADEQTFN
ANGISLSRPLIQKGPLYQKPHKHSVFSKYYVVLISGFIVLFHCFHRSTTGFAKEVLEYAH
YVTIPIDDCYLYSGTTTELDLLQRDRTFDEINYGSHALPRVYGDGWRSVEDESSRCFTLW
FGTRRALSSNRLQKKGNEKQYTQDYGRQDNNIDPPSAPEADLNNSNVPSNTDKIHFTKKL
GVSGKSMVFMARSRQERDLWVMSIYYELERLRRTASTSNSRNQTM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]