dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

SCRT_01681 (Saccharomyces cerevisiae RM11-1a )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | SCRG_01681 | Saccharomyces cerevisiae RM11-1a bud site selection protein 7 (747 aa)
Sequence length 746
Sequence
MITQNSIPEVKEDFIGYALHERRIRLPQFQDLGPADLVTLTKYLPTSSNTNAINSTSRNG
AAIIQSPAAVVADDSAASMATNGDASDTAVTTNYTNASIYSSSRNANDGAPMVAELHPLD
KLKDEVGTFFYSMGVDTSGPTSIAIFLKEISEVISEKPQVWFGRKKTFNVARISFSTWNA
FRRCDINVVVHIPGSIQNFIVDCNGESQNIEMCADYDLIWAETFVSGVVRSIMLMKENAE
EGELQNLVETLILNPFTAGQIDDVPEMFIDLFPIVYHKGPLLGAPYYITNVTNTNNYLVE
TLVEIVKLTRNVSRAEIMLKNLATDNPEAIIILIKIFLVCDQELDAIKLTYDMLSQDKII
NNTNNRMDYKSELLCLQAQFLIDKRQDYSLAQNIAQEAVNCSPSEFRPWYLLSKVYVKLN
DIENALLILNSCPMSPLKEKYVLKRVAPLPSNNSLHLPLPIDVVLDEVTSLNPQDVQNEH
RSADPMLVNLAASNLKSTFQLAYRLLTEIVQITGWENLLKYRSNIFVMEEEYQKSSSSLP
KDVNKQEEQPLRAKRLCERWLDNLFMLLYEDLKMYTLWQTEQLYMDAQNNNHNKLTFEWE
LFGLCARRLGHFPEAAKAFQNGLSQRFSSRCARKLLEYCINERQRVKNFINSPNSHDMVP
EIVSSRIRELDNSIIDLCVKICCWNHRWYTEFSISLLDCLSVVIQDMSLTKVSNEISSRY
PETVLNLVQENLLNFFTTCTIGCYDA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]