dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

SCRT_04630 (Saccharomyces cerevisiae RM11-1a )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | SCRG_04629 | Saccharomyces cerevisiae RM11-1a rho GTPase activating protein (2168 aa)
Sequence length 2167
Sequence
MKGLLWSKNRKSSTASASSSSTSTSHKTTTASTASSSSPSSSSQTIRNSTSGASPYMHSH
HHHGQGHSHHRGEDNNRDKRKSSVFPPSKQYTSTSSSQVNLGMYHSDTNTRSSRSIASTL
KDDSPSVCSEDEISNSSSQKSNAQDETPIAYKKSAHSKDSLLPSRSSSLSPPQSRCSTGT
TLEKSLNTSGISNNSGTNNNNSNNNNDNEQKQRNVIHLNSENYDTTVFKTGWVNKSHGQT
VATNYNSSMTAPSSSSSSSSQNLRNDAYSRNRESRFYGNDGSSLKNDDSSSTTATNSGND
VASARSSMAIDPQMLVPDYRLYRAQLKGCVLNLYKSGLNSNIKFFDPTLPASNSSIANEN
HRQKKQQTNSQAQAEALHQKQSFGQMGEPITLDLKYLSEVYPHPDLRQDSDGKIISGTIE
SLCHTVLFYPGPKQSDVPNEKSLSKTHRAVINLLLMFPLLDHFIKFLKVFNQFGLSFTKN
KSRLTNNSTQFYNISPAVDDSMTQRLALTAKTILDVFPGFLLDEPMLKTIISLLDTISSH
NDEISNNLKIKIANKHNELMKLTAFTRSLPMATSSTHELEIILDPSHFLSLDITTLADEV
HHINLKFDKVWAPKFDYSLLYDSKFINRRIVSLNPLVFNNDQNIHFLGRLLILHLFPTNP
EFSKKVTPKVRAELLDKWVQIGCRFEHLGDMVSWLAVATIICSIPVLRSSSWKYVPDQSL
KTILKDWVPTIIQLERRQRTSKSTSSVFILAPPNLDDDFTRANVISYFGDLLIHADDLPS
DTKFKYLEKKINRTKNAFHKWQQRLQAIDSTRHKTSSTENVRDNDSPNNVVYQLWKFHLS
QPPLNIEGIMKLSVQHEPPIIDQKAYSTIGSQRSALVTGSYLPILFNELFPNYSLFPKNT
LVGAASDAKLPPPRSSARLSKSLSISEPIPIASKSHTTGSLTDDAMSSKNDNNKVTGVGK
IDGPVIKEMSSKQSNKQRLLKSVRDVFNIDMDVFHISDELVFKSVYDNDGKSRPASMVIE
TPKRFSQHSSMLINNPATPNQKMRDSLDTTGRLSKTLENMDFFNNIGQVSDSLKESIIRV
VLKSSSLEKIFDLLVLTSNIFSKLVDTKDLENYYYHQRQRGHSTRGLSDDNIGLLDYAFV
KLTMDNDIFTETFFNTYKSFTTTTTVLENMAKRYVGAKSCSVSISKILDRSDDSKMKINE
DTNLVSSSLYDQNFPVWDMKVTDDENINLIYMAKIQIGAAEAILHLVKNHYSDFTDDLCN
NSTLLDIIKIMEQEVSTEWPTRIANSKLQKSLPENFVIETENLLTTLTDLFHGIKSAYQK
QLYRPIGVNRTQKRITDILNSFNTFSFTDLNNIIDDPSFSDDMIRSFQKLHSTNYEDILE
WIYQLDNFISKKFNLVSKKDWIVLFQELELLSKESLVSFFNYPLHFKSSKLINPGYLQLH
EFEISNLFTWISTLILKDDNGTESLFFEKLPQSIKLLIKLHTSLTTFFVMEISNVNKSSS
ERLTTCKVILQILNYIRWKNGSLDLFDSEEDESPHAICPHIPAFIETAIAHAIISPESRN
YELSWIKASEKLSDPTKGTQNLRSISNVLEKIDDIHIKRFIEIDDVFSKNCKNLCPCPGW
FISRLLEISQFVPNMSITNSKLINFDKRRFVNNIISNVLDLIPNEREFPLDIEMSDENPS
KRTTFGRILFNNFEDVNKAYRKKTKKVSESEAISERFQEQGVFNEILVNEIEKIKREARK
LEVLLDQEKILKNSAALHQAVPKKNRKSVIISGTHSDNDHSYNINKNTGQTPSLGSVMES
NNSARNRRDSRASFSTNRSSVVSNSSHNGVSKKIGGFFRRPFSIGGFNTSSSNYSLNSIL
SQEVSSNKSILPSILPEVDSMQLHDLKPSYSLKTFEIKSIMEIINHRNIPAYYYAFKIVM
QNGHEYLIQTASSSDLTEWIKMIKASKRFSFHSKKYKGKTHNKIFGVPLEDVCERENTLI
PTIVVKLLEEIELRGLDEVGLYRIPGSIGSINALKNAFDEEGATDNSFTLEDDRWFEVNA
IAGCFKMYLRELPDSLFSHAMVNDFTDLAIKYKAHAMVNEEYKRMMNELLQKLPTCYYQT
LKRIVFHLNKVHQHVVNNKMDASNLAIVFSMSFINQEDLANSMGSRLGAVQTILQDFIKN
PNDYFKQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]