dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|544161535|ref|YP_008537537.1| (Mycobacterium tuberculosis str. Haarlem)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment metal cation transporter P-type ATPase CtpV [Mycobacterium tuberculosis str. Haarlem]
Sequence length 792
Sequence
MTTDVLSDTDVSLKVVSNASGRMRVCVTGFNVDAVRAVAIEETVSQVTGVHAVHAYPRTA
SVVIWYSPELGDTAAVLSAITKAQHVPAELVPARAPHSAGVRGVGVVRKITGGIRRMLSR
PPGVDKPLKASRCGGRPRGPVRGSASWPGEQNRRERRTWLPRVWLALPLGLLALGSSMFF
GAYPWAGWLAFAATLPVQFVAGWPILRGAVQQARALTSNMDTLIALGTLTAFVYSTYQLF
AGGPLFFDTSALIIAFVVLGRHLEARATGKASEAISKLLELGAKEATLLVDGQELLVPVD
QVQVGDLVRVRPGEKIPVDGEVTDGRAAVDESMLTGESVPVEKTAGDRVAGATVNLDGLL
TVRATAVGADTALAQIVRLVEQAQGDKAPVQRLADRVSAVFVPAVIGVAVATFAGWTLIA
ANPVAGMTAAVAVLIIACPCALGLATPTAIMVGTGRGAELGILVKGGEVLEASKKIDTVV
FDKTGTLTRARMRVTDVIAGQRRQPDQVLRLAAAVESGSEHPIGAAIVAAAHERGLAIPA
ANAFTAVAGHGVRAQVNGGPVVVGRRKLVDEQHLVLPDHLAAAAVEQEERGRTAVFVGQD
GQVVGVLAVADTVKDDATDVVGRLHAMGLQVAMITGDNARTAAAIAKQVGIEKVLAEVLP
QDKVAEVRRLQDQGRVVAMVGDGVNDAPALVQADLGIAIGTGTDVAIEASDITLMSGRLD
GVVRAIELSRQTLRTIYQNLGWAFGYNTAAIPLAALGALNPVVAGAAMGFSSVSVVTNSL
RLRRFGRDGRTA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]