dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|427716804|ref|YP_007064798.1| (Calothrix sp. PCC 7507)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Cal7507_1500 [Calothrix sp. PCC 7507]
Sequence length 78
Sequence
MFTRNELTSKSLEELQQLSKNLGVEPIGNPTYPGSWIVPLLAVTQMAMQDCDLGRGLKAY
PSSRVYEPINLALVACLG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]