dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|15892682|ref|NP_360396.1| (Rickettsia conorii str. Malish 7)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transcription termination factor Rho [Rickettsia conorii str. Malish 7]
Sequence length 458
Sequence
MNTTNKESTAELNNTESNNNYNNFAENGNIINLKQLKRKLPEELQAQAEELKIENINSLL
KQELVFAILKKSVEQGVLIVGEGVLEVLPDGFGFLRSPEVNYLAGPDDIYISPSQIRRFG
LRTGDTVEGQIRAPKAGERYFALLKVNRVNFEDPSKAYHRVHFDNLTPLYPDEKLGLELE
NNSKDSKDFSTRVIELVAPMGKGQRALIVAPPRTGKTVLLQNIAHAITTNNPEVFLIVLL
IDERPEEVTDMQRSVRGEVVSSTFDEPASRHVQLAEMVIKKAKRLVEHKKDVVILVDAIT
RLARAYNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIENGGSLTIIGTALIETGSRMD
EVIFEEFKGTGNSEIVLDRKIADKRIYPAIDITRSGTRKEDLLVDKIILNKMWVLRRIID
PMGSSEAIEFLLKKLENTKTNGEFFEMMKSPERPKNGL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]