dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSMMUP00000004206 (Macaca mulatta 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection chromosome:MMUL_1:6:76241054:76287019:1 gene:ENSMMUG00000003143 transcript:ENSMMUT00000004457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 961
Sequence
MLAPRGAAVLLLHLVLQPWLAAGAQATPQVFDLLPSSSQRVNPGALLPVLTDQALNDLYV
ISTFKLQTKSSATIFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKVHLVVFNNLQLA
DGRRHRLLLRLSNLQRGAGSLELYLDCIQVDSIHNLPRAFAGLSQNPETIELRTFQRKPQ
DFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATGTGDFNRQFLGQMTQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLKFQSPTPSTVVPPAPPAPPTRPPRRCDSNPCFRGVQ
CTDSRDGFQCGPCPEGYTGNGITCIDVDECKYHPCYPGVRCVNLSPGFRCDACPVGFTGP
MVQGVGISFAKSNKQVCTDIDECRNGACVSNSICINTLGSYRCGPCKPGYTGDQIRGCKM
ERNCRNPELNPCSVNARCIEERQGDVTCVCGVGWAGDGYVCGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLIHNVDQRNSDKDIFG
DACDNCLSVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNCPRFPNRDQRDKDGDGVGD
ACDSCPDISNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIG
DECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICESDFDQDQVIDRIDVCP
ENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVD
FEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK
SKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE
GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLD
N

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]