dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSMMUP00000019493 (Macaca mulatta 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel scaffold:MMUL_1:1099214732204:21613:30350:-1 gene:ENSMMUG00000014848 transcript:ENSMMUT00000020832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 134
Sequence
MASRSMRLLLLLNCLAKIGVLGDVIRRPSCAPGWFYHKPNCYGYFRKLRNWSDAEVRNLP
PAWPGLSRAKDQPEPQISFDSGSSVLPGHYEEKPLWLVKWREEGCVFNSFNSVSIAEAGA
VCHTLDGLQAHTDT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]